Property Summary

NCBI Gene PubMed Count 99
PubMed Score 135.17
PubTator Score 162.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.4e-06
Breast cancer 1.100 4.3e-06
colon cancer 1.100 4.0e-02
ependymoma -1.300 1.5e-06
glioblastoma -1.100 2.8e-03
medulloblastoma, large-cell -1.400 1.2e-04
osteosarcoma -2.278 9.6e-07
ovarian cancer -2.100 4.0e-06
pancreatic ductal adenocarcinoma liver m... -2.488 1.6e-04
pituitary cancer 1.100 2.8e-03

Protein-protein Interaction (7)

Gene RIF (69)

AA Sequence

MERLWGLFQRAQQLSPRSSQTVYQRVEGPRKGHLEEEEEDGEEGAETLAHFCPMELRGPEPLGSRPRQPN      1 - 70
LIPWAAAGRRAAPYLVLTALLIFTGAFLLGYVAFRGSCQACGDSVLVVSEDVNYEPDLDFHQGRLYWSDL     71 - 140
QAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIRAALSRQKLDHVWTDTHYVGLQFPDPAHPNT    141 - 210
LHWVDEAGKVGEQLPLEDPDVYCPYSAIGNVTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISF    211 - 280
AQKVTNAQDFGAQGVLIYPEPADFSQDPPKPSLSSQQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVASSG    281 - 350
LPSIPAQPISADIASRLLRKLKGPVAPQEWQGSLLGSPYHLGPGPRLRLVVNNHRTSTPINNIFGCIEGR    351 - 420
SEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGDFGSVGSTEWL    421 - 490
EGYLSVLHLKAVVYVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFTNPSWDAE    491 - 560
VIRPLPMDSSAYSFTAFVGVPAVEFSFMEDDQAYPFLHTKEDTYENLHKVLQGRLPAVAQAVAQLAGQLL    561 - 630
IRLSHDRLLPLDFGRYGDVVLRHIGNLNEFSGDLKARGLTLQWVYSARGDYIRAAEKLRQEIYSSEERDE    631 - 700
RLTRMYNVRIMRVEFYFLSQYVSPADSPFRHIFMGRGDHTLGALLDHLRLLRSNSSGTPGATSSTGFQES    701 - 770
RFRRQLALLTWTLQGAANALSGDVWNIDNNF                                           771 - 801
//

Text Mined References (103)

PMID Year Title