Property Summary

NCBI Gene PubMed Count 94
Grant Count 73
R01 Count 37
Funding $4,750,534.67
PubMed Score 130.08
PubTator Score 162.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -4.790 0.000
posterior fossa group B ependymoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
glioblastoma -1.100 0.003
medulloblastoma, large-cell -1.400 0.000
pancreatic ductal adenocarcinoma liver m... -2.488 0.000
colon cancer 1.100 0.040
Breast cancer 1.100 0.000
ovarian cancer -2.100 0.000
pituitary cancer 1.100 0.003

Synonym

Accession Q9UP52 A6NGM7 O75422 Q1HE13 Q9HA99 Q9NX67 TfR2
Symbols HFE3
TFRC2

Gene

PANTHER Protein Class (1)

Gene RIF (65)

PMID Text
25637053 Our results indicate that membrane transferrin receptor-2, a sensor of circulating iron, is released from the cell membrane in iron deficiency.
25635054 results suggest that down-regulation of CD81 by GRAIL targets TfR2 for degradation
25000850 In line with a status of iron deficiency, gene expression studies suggested decreased expression of transferrin and transferrin receptor 2 in non-alcoholic steatohepatitis livers
24901155 Authors investigated the expression of TfR1 and TfR2 in human HCC tissues by immunohistochemistry, the first report demonstrating TfR2 expression immunohistochemically in human HCC.
24648608 Polymorphisms of the TRF2 gene may be associated with age-related macular degeneration occurrence, either directly or by modulation of risk factors.
24055163 Present findings support the hypothesis of a main role of the TFR2 gene in HH pathogenesis in those regions, such as Central-Southern Italy, where the p.C282Y frequency is low.
23817740 Studies indicate that several genes have been linked to iron homeostasis, including transferrin (TF), iron regulatory protein 1 (ACO1) and transferrin receptor 2 (TFR2).
23751596 The variants of rs2075674 and rs7385804 in TFR2 gene were not associated with coronary heart disease risk in a Chinese Han population.
23556518 N-linked glycosylation is dispensable for the cell surface expression and holo-Tf binding, but it is required for efficient intersubunit disulfide bond formation and holo-Tf-induced stabilization of TfR2.
22890139 Mutations in the TFR2 gene is associated with hemochromatosis.
More...

AA Sequence

MERLWGLFQRAQQLSPRSSQTVYQRVEGPRKGHLEEEEEDGEEGAETLAHFCPMELRGPEPLGSRPRQPN      1 - 70
LIPWAAAGRRAAPYLVLTALLIFTGAFLLGYVAFRGSCQACGDSVLVVSEDVNYEPDLDFHQGRLYWSDL     71 - 140
QAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIRAALSRQKLDHVWTDTHYVGLQFPDPAHPNT    141 - 210
LHWVDEAGKVGEQLPLEDPDVYCPYSAIGNVTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISF    211 - 280
AQKVTNAQDFGAQGVLIYPEPADFSQDPPKPSLSSQQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVASSG    281 - 350
LPSIPAQPISADIASRLLRKLKGPVAPQEWQGSLLGSPYHLGPGPRLRLVVNNHRTSTPINNIFGCIEGR    351 - 420
SEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGDFGSVGSTEWL    421 - 490
EGYLSVLHLKAVVYVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFTNPSWDAE    491 - 560
VIRPLPMDSSAYSFTAFVGVPAVEFSFMEDDQAYPFLHTKEDTYENLHKVLQGRLPAVAQAVAQLAGQLL    561 - 630
IRLSHDRLLPLDFGRYGDVVLRHIGNLNEFSGDLKARGLTLQWVYSARGDYIRAAEKLRQEIYSSEERDE    631 - 700
RLTRMYNVRIMRVEFYFLSQYVSPADSPFRHIFMGRGDHTLGALLDHLRLLRSNSSGTPGATSSTGFQES    701 - 770
RFRRQLALLTWTLQGAANALSGDVWNIDNNF                                           771 - 801
//

Text Mined References (98)

PMID Year Title
25637053 2015 Regulation of cell surface transferrin receptor-2 by iron-dependent cleavage and release of a soluble form.
25635054 2015 CD81 promotes both the degradation of transferrin receptor 2 (TfR2) and the Tfr2-mediated maintenance of hepcidin expression.
25352340 2014 Novel loci affecting iron homeostasis and their effects in individuals at risk for hemochromatosis.
25000850 2015 Novel pathway for iron deficiency in pediatric non-alcoholic steatohepatitis.
24901155 Immunohistochemical demonstration of transferrin receptor 1 and 2 in human hepatocellular carcinoma tissue.
24648608 2014 Variability of the transferrin receptor 2 gene in AMD.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24055163 TFR2-related hereditary hemochromatosis as a frequent cause of primary iron overload in patients from Central-Southern Italy.
23817740 2013 Neuroimaging, nutrition, and iron-related genes.
23751596 2014 Association between genetic variations in TFR2 gene and coronary heart disease in Chinese: a case-control study.
More...