Property Summary

NCBI Gene PubMed Count 43
Grant Count 160
R01 Count 100
Funding $15,688,316.45
PubMed Score 74.25
PubTator Score 33.16

Knowledge Summary

Patent (9,908)

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.019
psoriasis -1.200 0.000
osteosarcoma 1.494 0.017
ependymoma 1.400 0.000
group 3 medulloblastoma 4.300 0.000
atypical teratoid / rhabdoid tumor 2.800 0.000
glioblastoma 1.900 0.000
medulloblastoma, large-cell 1.900 0.000
tuberculosis 1.200 0.000
interstitial cystitis -1.500 0.020
non primary Sjogren syndrome sicca 1.200 0.018
non-inflammatory breast cancer -1.500 0.003
ovarian cancer 2.100 0.004

Synonym

Accession Q9UP38 A4D1E8 O94815 Q549T8 Fz-1
Symbols

Gene

Gene RIF (25)

PMID Text
25369469 FZD1 expression was down-regulated by AP2 expression and mediated osteoblast differentiation and mineralization.
25197350 Our study suggests that Sox9 siRNA inhibits the proliferation capability of human osteosarcoma cells by down-regulating the expression of Wnt1 and its receptor Fzd1
24814288 our data demonstrate that FZD1 regulates PKCdelta, and the PKCdelta/AP-1 signalling transduction pathway plays an important role in drug resistance in MES-SA/Dx5 cells.
24386373 Polymorphisms in several genes involved in the Wnt signaling pathway were associated with hepatic fibrosis or inflammation risk in HCV-infected males.
23921915 ACE2 and FZD1 are prognosis markers in squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder.
23806799 Experiments demonstrate a role of E2F1 in osteoblast differentiation and mineralization and suggest that FZD1 is required, in part, for E2F1 regulation of osteoblast mineralization.
23442549 Fz1 is a Wnt responsive gene in colon-derived tissues. Fz1 expression exhibited increased expression in normal mucosa only in close proximity to colon cancer
22484497 FZD1 appears to mediate multidrug resistance by regulating the Wnt/beta-catenin pathway
22303445 Soluble FZC18 and Wnt3a physically interact in a cell-free system and soluble FZC18 binds the frizzled 1 and 8 receptors.
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLWLLEAPLLLGV      1 - 70
RAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGH     71 - 140
TNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWP    141 - 210
DTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRAL    211 - 280
KVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSY    281 - 350
PERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW    351 - 420
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGF    421 - 490
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQA    491 - 560
FRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSW    561 - 630
RKFYTRLTNSKQGETTV                                                         631 - 647
//

Text Mined References (43)

PMID Year Title
25369469 2015 AP2 suppresses osteoblast differentiation and mineralization through down-regulation of Frizzled-1.
25197350 2014 Sox9 regulates hyperexpression of Wnt1 and Fzd1 in human osteosarcoma tissues and cells.
24814288 2014 FZD1 activates protein kinase C delta-mediated drug-resistance in multidrug-resistant MES-SA/Dx5 cancer cells.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24386373 2013 WNT signaling pathway gene polymorphisms and risk of hepatic fibrosis and inflammation in HCV-infected patients.
23921915 2014 ACE2 and FZD1 are prognosis markers in squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder.
23806799 2013 E2F1 effects on osteoblast differentiation and mineralization are mediated through up-regulation of frizzled-1.
23461676 2013 Uncovering novel actors in astrocyte-neuron crosstalk in Parkinson's disease: the Wnt/?-catenin signaling cascade as the common final pathway for neuroprotection and self-repair.
23442549 2013 Invasive colon cancer, but not non-invasive adenomas induce a gradient effect of Wnt pathway receptor frizzled 1 (Fz1) expression in the tumor microenvironment.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
More...