Property Summary

NCBI Gene PubMed Count 46
PubMed Score 78.42
PubTator Score 33.16

Knowledge Summary

Patent (9,908)

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 2.1e-03
Breast cancer -1.300 1.4e-05
ependymoma 1.200 8.2e-09
glioblastoma 1.900 1.4e-04
group 3 medulloblastoma 3.300 4.5e-07
interstitial cystitis -1.500 2.0e-02
medulloblastoma, large-cell 1.900 3.9e-04
non primary Sjogren syndrome sicca 1.200 1.8e-02
osteosarcoma 1.494 1.7e-02
ovarian cancer -1.900 4.2e-05
psoriasis -1.200 6.7e-08
Rheumatoid arthritis 1.200 1.9e-02
tuberculosis 1.100 4.1e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLWLLEAPLLLGV      1 - 70
RAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGH     71 - 140
TNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWP    141 - 210
DTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRAL    211 - 280
KVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSY    281 - 350
PERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW    351 - 420
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGF    421 - 490
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQA    491 - 560
FRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSW    561 - 630
RKFYTRLTNSKQGETTV                                                         631 - 647
//

Text Mined References (46)

PMID Year Title