Property Summary

NCBI Gene PubMed Count 25
Grant Count 1
Funding $154,986.75
PubMed Score 8.42
PubTator Score 4.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.336 0.000
adult high grade glioma -1.100 0.001
ovarian cancer 1.600 0.000

Synonym

Accession Q9UNZ2 A2A2L1 B2RD74 Q5JXA4 Q5JXA5 Q7Z533 Q9H102 Q9NVL9 Q9UI06
Symbols P47
UBX1
UBXD10
UBXN2C
dJ776F14.1

Gene

 Grant Application (1)

PDB

1SS6  

Gene RIF (4)

PMID Text
24612679 The present results for the first time demonstrate that BDNF induces NADPH oxidase -derived reactive oxygen species generation through activation of p47 phox in a TrkB receptor-dependent manner
23649807 human p37/p47 and their C. elegans orthologue UBXN-2 regulate centrosome function in prophase by limiting the recruitment of Aurora A
22990857 The binding of p47 to polyubiquitinated NEMO triggers the lysosomal degradation of NEMO, thereby inhibiting IKK activation.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDN      1 - 70
RVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKS     71 - 140
PGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFL    141 - 210
ESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENE    211 - 280
AKASSSILIDESEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD    281 - 350
ESQTLKEANLLNAVIVQRLT                                                      351 - 370
//

Text Mined References (36)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24612679 2014 Brain-derived neurotrophic factor promotes angiogenic tube formation through generation of oxidative stress in human vascular endothelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23649807 2013 The UBXN-2/p37/p47 adaptors of CDC-48/p97 regulate mitosis by limiting the centrosomal recruitment of Aurora A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990857 2012 p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...