Property Summary

NCBI Gene PubMed Count 29
PubMed Score 9.42
PubTator Score 4.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.9e-04
ovarian cancer 8520 3.8e-04
adult high grade glioma 3801 6.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 6.9e-04
osteosarcoma -1.336 2.9e-04
ovarian cancer 1.100 3.8e-04

Gene RIF (5)

AA Sequence

MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDN      1 - 70
RVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKS     71 - 140
PGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFL    141 - 210
ESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENE    211 - 280
AKASSSILIDESEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD    281 - 350
ESQTLKEANLLNAVIVQRLT                                                      351 - 370
//

Text Mined References (40)

PMID Year Title