Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Asperger syndrome 37 5.067 2.5

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.700 3.6e-05
hepatocellular carcinoma 1.300 2.2e-04
lung cancer 1.400 5.3e-03
osteosarcoma -1.164 1.9e-02
ovarian cancer -1.100 7.6e-04
primitive neuroectodermal tumor 1.200 5.1e-03
tuberculosis -1.100 1.1e-02

AA Sequence

MAVSLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFRHLRYQETPGPREAL      1 - 70
SQLRVLCCEWLRPEKHTKEQILEFLVLEQFLTILPEELQSWVRGHHPKSGEEAVTVLEDLEKGLEPEPQV     71 - 140
PGPAHGPAQEEPWEKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPI    141 - 210
TEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKEIPTGKKDHECSE    211 - 280
CGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKAFRWGAHLVQH    281 - 350
QRIHSGEKPYECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRVHARKEPSH       351 - 417
//

Text Mined References (10)

PMID Year Title