Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 2.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma 1.300 0.000
osteosarcoma -1.164 0.019
primitive neuroectodermal tumor 1.200 0.005
tuberculosis and treatment for 6 months -2.000 0.000
lung cancer 1.900 0.000
group 3 medulloblastoma 1.700 0.000
ovarian cancer -1.100 0.001

AA Sequence

MAVSLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFRHLRYQETPGPREAL      1 - 70
SQLRVLCCEWLRPEKHTKEQILEFLVLEQFLTILPEELQSWVRGHHPKSGEEAVTVLEDLEKGLEPEPQV     71 - 140
PGPAHGPAQEEPWEKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPI    141 - 210
TEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKEIPTGKKDHECSE    211 - 280
CGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKAFRWGAHLVQH    281 - 350
QRIHSGEKPYECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRVHARKEPSH       351 - 417
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11311944 2001 ZNF232: structure and expression analysis of a novel human C(2)H(2) zinc finger gene, member of the SCAN/LeR domain subfamily.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.