Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UNX3 B3KY82 D3DQM0
Symbols RPL26P1

Gene

AA Sequence

MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV      1 - 70
VQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELI     71 - 140
EKMQE                                                                     141 - 145
//

Text Mined References (10)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15189156 2004 The molecular mechanics of eukaryotic translation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.