Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV      1 - 70
VQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELI     71 - 140
EKMQE                                                                     141 - 145
//

Text Mined References (11)

PMID Year Title