Property Summary

NCBI Gene PubMed Count 10
Grant Count 8
R01 Count 1
Funding $134,529.7
PubMed Score 36.89
PubTator Score 479.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

PMID Text
17436242 SCN1A polymorphism has a dramatic effect on the proportions of neonate and adult alternative transcripts of SCN1A in adult brain tissue and, the effect of the polymorphism also appears to be modified by Nova2 expression levels.

AA Sequence

MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSK      1 - 70
SKDFYPGTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQAKLIVPNS     71 - 140
TAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAIVQKVQEDPQSSSCL    141 - 210
NISYANVAGPVANSNPTGSPYASPADVLPAAAAASAAAASGLLGPAGLAGVGAFPAALPAFSGTDLLAIS    211 - 280
TALNTLASYGYNTNSLGLGLNSAAASGVLAAVAAGANPAAAAAANLLASYAGEAGAGPAGGAAPPPPPPP    281 - 350
GALGSFALAAAANGYLGAGAGGGAGGGGGPLVAAAAAAGAAGGFLTAEKLAAESAKELVEIAVPENLVGA    351 - 420
ILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQAAQYLISQRVTYEQGVRASNPQK    421 - 490
VG                                                                        491 - 492
//

Text Mined References (10)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17436242 2007 Nova2 interacts with a cis-acting polymorphism to influence the proportions of drug-responsive splice variants of SCN1A.
15057824 2004 The DNA sequence and biology of human chromosome 19.
10735272 1997 ANOVA, a putative astrocytic RNA-binding protein gene that maps to chromosome 19q13.3.
10676814 2000 Sequence-specific RNA binding by a Nova KH domain: implications for paraneoplastic disease and the fragile X syndrome.
10368286 1999 Crystal structures of Nova-1 and Nova-2 K-homology RNA-binding domains.
9789075 1998 The neuronal RNA-binding protein Nova-2 is implicated as the autoantigen targeted in POMA patients with dementia.
9344654 1997 Mouse chromosomal locations of nine genes encoding homologs of human paraneoplastic neurologic disorder antigens.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.