Property Summary

NCBI Gene PubMed Count 10
PubMed Score 37.50
PubTator Score 479.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.800 2.9e-06
Astrocytoma, Pilocytic -1.500 2.3e-08
atypical teratoid / rhabdoid tumor -1.600 3.3e-05
ependymoma -1.400 3.9e-10
glioblastoma -1.400 4.8e-07
group 3 medulloblastoma -2.100 3.1e-05
invasive ductal carcinoma -1.200 5.4e-03
medulloblastoma, large-cell -1.900 1.2e-03
progressive supranuclear palsy 1.300 2.4e-02

Gene RIF (1)

AA Sequence

MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSK      1 - 70
SKDFYPGTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQAKLIVPNS     71 - 140
TAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAIVQKVQEDPQSSSCL    141 - 210
NISYANVAGPVANSNPTGSPYASPADVLPAAAAASAAAASGLLGPAGLAGVGAFPAALPAFSGTDLLAIS    211 - 280
TALNTLASYGYNTNSLGLGLNSAAASGVLAAVAAGANPAAAAAANLLASYAGEAGAGPAGGAAPPPPPPP    281 - 350
GALGSFALAAAANGYLGAGAGGGAGGGGGPLVAAAAAAGAAGGFLTAEKLAAESAKELVEIAVPENLVGA    351 - 420
ILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQAAQYLISQRVTYEQGVRASNPQK    421 - 490
VG                                                                        491 - 492
//

Text Mined References (11)

PMID Year Title