Property Summary

NCBI Gene PubMed Count 21
PubMed Score 494.81
PubTator Score 48.10

Knowledge Summary

Patent (14,636)


  Disease (3)

Disease Target Count P-value
tuberculosis 2010 2.4e-06
invasive ductal carcinoma 2951 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Leishmaniasis 47 3.42 1.7
Cancer 2499 3.387 1.7


  Differential Expression (2)

Disease log2 FC p
invasive ductal carcinoma 1.408 1.8e-03
tuberculosis -1.300 2.4e-06

Gene RIF (14)

AA Sequence

VALADHYTFSRPVHPPGSPCPAKRLIEESC                                            351 - 380

Text Mined References (25)

PMID Year Title