Property Summary

NCBI Gene PubMed Count 20
Grant Count 47
R01 Count 22
Funding $6,399,952.56
PubMed Score 482.02
PubTator Score 48.10

Knowledge Summary

Patent (14,636)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis -2.600 0.000
invasive ductal carcinoma 1.408 0.002

Gene RIF (13)

PMID Text
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19855098 we found an additional novel G2A variant (G2A-b) that is the major transcript with functional response to ligand stimulation as well as G2A-a, and succeeded in discriminating proton-sensing and oxidized fatty acid-sensing activities of G2A.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18089568 the G-protein-coupled receptor G2A, unlike its relative GPR4, is involved in the chemotaxis of monocytic cells.
18034171 9-HODE-G2A signaling plays proinflammatory roles in skin under oxidative conditions
17475884 G2A latent within neutrophil secretory vesicles may facilitate signaling through lysophospholipids for neutrophil activation and calcium flux.
16236715 results indicate that G protein-coupled receptor G2A is a receptor for 9-hydroxyoctadecadienoic acid (9-HODE) and other oxidized free fatty acids and is activated by oxidized free fatty acids
15665078 Activity of the human G2A receptor is less sensitive to pH fluctuations as measured by inositol phosphate and cAMP accumulation.
15280385 G2A is a proton-sensing G-protein-coupled receptor antagonized by lysophosphatidylcholine
12805023 G2A was not detected in either brain or skin vascular endothelial cell type.
More...

AA Sequence

MCPMLLKNGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRIVLVVVYSAVCTLGVPANCLTAWLALLQ      1 - 70
VLQGNVLAVYLLCLALCELLYTGTLPLWVIYIRNQHRWTLGLLACKVTAYIFFCNIYVSILFLCCISCDR     71 - 140
FVAVVYALESRGRRRRRTAILISACIFILVGIVHYPVFQTEDKETCFDMLQMDSRIAGYYYARFTVGFAI    141 - 210
PLSIIAFTNHRIFRSIKQSMGLSAAQKAKVKHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMC    211 - 280
GLEERLYTASVVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSP    281 - 350
VALADHYTFSRPVHPPGSPCPAKRLIEESC                                            351 - 380
//

Text Mined References (24)

PMID Year Title
22621271 2012 Therapeutic options for transfusion related acute lung injury; the potential of the G2A receptor.
20799926 2010 Lysophosphatidylcholines activate G2A inducing G(?i)??-/G(?q/)??- Ca²(+) flux, G(??)-Hck activation and clathrin/?-arrestin-1/GRK6 recruitment in PMNs.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19855098 2010 Identification and analysis of two splice variants of human G2A generated by alternative splicing.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18089568 2008 Migration to apoptotic "find-me" signals is mediated via the phagocyte receptor G2A.
18034171 2008 G2A plays proinflammatory roles in human keratinocytes under oxidative stress as a receptor for 9-hydroxyoctadecadienoic acid.
17475884 2007 Lysophospholipids of different classes mobilize neutrophil secretory vesicles and induce redundant signaling through G2A.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...