Property Summary

NCBI Gene PubMed Count 21
PubMed Score 32.43
PubTator Score 20.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -4.000 1.2e-02
cutaneous lupus erythematosus 1.100 2.8e-02
esophageal adenocarcinoma 1.100 1.8e-02
gastric cancer 1.400 3.2e-04
group 3 medulloblastoma 1.300 2.3e-04
hepatocellular carcinoma 1.700 1.0e-06
lung cancer 1.600 1.2e-04
nasopharyngeal carcinoma 1.200 7.0e-04
osteosarcoma -2.412 1.7e-06
ovarian cancer -1.800 5.7e-06
pancreatic cancer 1.600 2.0e-03
pancreatic carcinoma 1.600 2.0e-03
primary Sjogren syndrome 1.300 2.9e-05
psoriasis 1.500 3.4e-04
tuberculosis -1.300 7.0e-05

 MGI Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (6)

AA Sequence

MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD      1 - 70
PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD     71 - 140
WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD    141 - 210
VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL    211 - 280
IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKA    281 - 350
VEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY    351 - 420
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL       421 - 487
//

Text Mined References (25)

PMID Year Title