Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
Funding $40,470.67
PubMed Score 29.35
PubTator Score 20.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.400 0.000
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 1.600 0.002
esophageal adenocarcinoma 1.100 0.018
cutaneous lupus erythematosus 1.100 0.028
psoriasis 1.500 0.000
osteosarcoma -2.412 0.000
tuberculosis and treatment for 3 months -1.500 0.000
lung cancer 1.600 0.000
group 3 medulloblastoma 1.300 0.000
primary Sjogren syndrome 1.300 0.000
pancreatic carcinoma 1.600 0.002
nasopharyngeal carcinoma 1.200 0.001
acute myeloid leukemia -4.000 0.012
ovarian cancer -1.800 0.000

Synonym

Accession Q9UNW1 F5H683 O95172 O95286 Q59EJ2 Q9UGA3
Symbols MIPP
HIPER1
MINPP2

Gene

Gene RIF (5)

PMID Text
23186306 By RNA knockdown, we identified secreted and lysosome targeted MINPP1 (multiple inositol-polyphosphate phosphatase 1), the mammalian 3-phytase, to be essentially involved both in extracellular and in lysosomal InsP6 dephosphorylation
21071540 Observational study of gene-disease association. (HuGE Navigator)
20304771 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of multiple inositol-polyphosphate phosphatase 1 (MINPP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD      1 - 70
PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD     71 - 140
WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD    141 - 210
VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL    211 - 280
IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKA    281 - 350
VEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY    351 - 420
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL       421 - 487
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186306 2013 Tumour cells can employ extracellular Ins(1,2,3,4,5,6)P(6) and multiple inositol-polyphosphate phosphatase 1 (MINPP1) dephosphorylation to improve their proliferation.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20304771 2010 A meta-analysis of four genome-wide association studies of survival to age 90 years or older: the Cohorts for Heart and Aging Research in Genomic Epidemiology Consortium.
18413611 2008 Dephosphorylation of 2,3-bisphosphoglycerate by MIPP expands the regulatory capacity of the Rapoport-Luebering glycolytic shunt.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16759730 2006 Avian multiple inositol polyphosphate phosphatase is an active phytase that can be engineered to help ameliorate the planet's "phosphate crisis".
More...