Property Summary

NCBI Gene PubMed Count 15
Grant Count 30
R01 Count 23
Funding $2,214,188.92
PubMed Score 38.28
PubTator Score 20.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Gene RIF (9)

PMID Text
24226095 RORalpha is a key regulator of diurnal rhythm and fasting induction of CYP8B1, which regulates bile acid composition and serum and liver cholesterol levels.
23216301 The single nucleotide polymorphism rs3732860 in the 3'-untranslated region of the CYP8B1 gene is associated with risk of Gallstone Disease in Chinese Han.
22093981 SNP rs3732860 of CYP8B1 gene is associated with gallstone disease in this Chinese population.
19898482 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
17585019 Isoflavone-related induction of 12-alpha-hydroxylase (CYP8B1) was studied in vitro and murine in vivo models.
16937432 T(3) dose-dependently decreased total bile acid formation in parallel with decreased expression of CYP7A1 and CYP8B1
15891895 Studies indicate a homogenous pattern for CYP8B1 expression in human liver, which was even rather than zonal.
15249218 Cholesterol loading reduces SREBP-1 mRNA expression in addition to reducing functional SREBP-1 protein, and results in decreasing CYP8B1 gene transcription.

AA Sequence

MVLWGPVLGALLVVIAGYLCLPGMLRQRRPWEPPLDKGTVPWLGHAMAFRKNMFEFLKRMRTKHGDVFTV      1 - 70
QLGGQYFTFVMDPLSFGSILKDTQRKLDFGQYAKKLVLKVFGYRSVQGDHEMIHSASTKHLRGDGLKDLN     71 - 140
ETMLDSLSFVMLTSKGWSLDASCWHEDSLFRFCYYILFTAGYLSLFGYTKDKEQDLLQAGELFMEFRKFD    141 - 210
LLFPRFVYSLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVPSAMQDKFNFMML    211 - 280
WASQGNTGPTSFWALLYLLKHPEAIRAVREEATQVLGEARLETKQSFAFKLGALQHTPVLDSVVEETLRL    281 - 350
RAAPTLLRLVHEDYTLKMSSGQEYLFRHGDILALFPYLSVHMDPDIHPEPTVFKYDRFLNPNGSRKVDFF    351 - 420
KTGKKIHHYTMPWGSGVSICPGRFFALSEVKLFILLMVTHFDLELVDPDTPLPHVDPQRWGFGTMQPSHD    421 - 490
VRFRYRLHPTE                                                               491 - 501
//

Text Mined References (18)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24226095 2013 Retinoic acid-related orphan receptor ? regulates diurnal rhythm and fasting induction of sterol 12?-hydroxylase in bile acid synthesis.
23216301 2013 Single nucleotide polymorphism rs3732860 in the 3'-untranslated region of CYP8B1 gene is associated with gallstone disease in Han Chinese.
22093981 2011 [Association of single nucleotide polymorphism in human CYP8B1 gene with gallstone disease].
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
17585019 2007 Human and murine hepatic sterol-12-alpha-hydroxylase and other xenobiotic metabolism mRNA are upregulated by soy isoflavones.
16937432 2006 Suppression of bile acid synthesis by thyroid hormone in primary human hepatocytes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...