Property Summary

NCBI Gene PubMed Count 15
PubMed Score 40.51
PubTator Score 20.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cholestasis 155 5.172 2.6
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cerebrotendinous xanthomatosis 13 3.512 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 3.2e-04
pancreatic ductal adenocarcinoma liver m... -3.697 6.9e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (9)

AA Sequence

MVLWGPVLGALLVVIAGYLCLPGMLRQRRPWEPPLDKGTVPWLGHAMAFRKNMFEFLKRMRTKHGDVFTV      1 - 70
QLGGQYFTFVMDPLSFGSILKDTQRKLDFGQYAKKLVLKVFGYRSVQGDHEMIHSASTKHLRGDGLKDLN     71 - 140
ETMLDSLSFVMLTSKGWSLDASCWHEDSLFRFCYYILFTAGYLSLFGYTKDKEQDLLQAGELFMEFRKFD    141 - 210
LLFPRFVYSLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVPSAMQDKFNFMML    211 - 280
WASQGNTGPTSFWALLYLLKHPEAIRAVREEATQVLGEARLETKQSFAFKLGALQHTPVLDSVVEETLRL    281 - 350
RAAPTLLRLVHEDYTLKMSSGQEYLFRHGDILALFPYLSVHMDPDIHPEPTVFKYDRFLNPNGSRKVDFF    351 - 420
KTGKKIHHYTMPWGSGVSICPGRFFALSEVKLFILLMVTHFDLELVDPDTPLPHVDPQRWGFGTMQPSHD    421 - 490
VRFRYRLHPTE                                                               491 - 501
//

Text Mined References (18)

PMID Year Title