Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.98
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.773 9.6e-05
non primary Sjogren syndrome sicca 1.400 1.4e-02
osteosarcoma -1.045 3.0e-03
Waldenstrons macroglobulinemia 1.099 2.6e-02

Gene RIF (4)

AA Sequence

MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNM      1 - 70
TVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFK     71 - 140
LLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIE    141 - 210
PKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADKIQQIL    211 - 280
TSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS                                         281 - 313
//

Text Mined References (13)

PMID Year Title