Property Summary

Ligand Count 160
NCBI Gene PubMed Count 694
PubMed Score 2731.12
PubTator Score 1791.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Gout 104 5.366 2.7
Dental caries 164 0.0 2.9
Disease Target Count Z-score Confidence
Cancer 2499 6.131 3.1

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease -3.180 2.5e-02
adrenocortical adenoma -1.098 1.6e-02
adrenocortical carcinoma -1.573 1.1e-03
Astrocytoma, Pilocytic 1.100 1.7e-04
Breast cancer -1.500 9.2e-16
cutaneous lupus erythematosus 1.500 6.0e-03
lung adenocarcinoma -1.300 7.6e-10
lung cancer -1.700 7.8e-04
malignant mesothelioma -6.900 1.9e-09
medulloblastoma, large-cell -1.500 2.3e-03
non-small cell lung cancer -1.838 3.5e-20
osteosarcoma -1.252 2.1e-03
ulcerative colitis -5.200 1.6e-07
urothelial carcinoma 1.500 3.4e-03

Protein-protein Interaction (9)

Gene RIF (688)

AA Sequence

MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGI      1 - 70
MKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENL     71 - 140
QFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLD    141 - 210
EPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESA    211 - 280
GYHCEAYNNPADFFLDIINGDSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELH    281 - 350
QLSGGEKKKKITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS    351 - 420
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLPMRMLPSIIFT    421 - 490
CIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLLMTICFVFMMIFSGLLVNLTT    491 - 560
IASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH    561 - 630
VALACMIVIFLTIAYLKLLFLKKYS                                                 631 - 655
//

Text Mined References (699)

PMID Year Title