Property Summary

NCBI Gene PubMed Count 26
PubMed Score 20.96
PubTator Score 24.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.3e-04

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 5.3e-04

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNES      1 - 70
ELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNP     71 - 140
QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG    141 - 210
GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEA    211 - 280
QGSKDGKPKQKVIIADCGEYV                                                     281 - 301
//

Text Mined References (30)

PMID Year Title