Property Summary

NCBI Gene PubMed Count 34
PubMed Score 68.25
PubTator Score 74.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Amish Infantile Epilepsy Syndrome 1 0.0 0.0
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.2e-04
colon cancer -1.400 4.3e-02
interstitial cystitis -1.200 6.6e-04
lung cancer -1.900 1.0e-03
lung carcinoma -1.800 1.3e-21
medulloblastoma -1.100 1.4e-04
medulloblastoma, large-cell -1.500 2.7e-05
non-small cell lung cancer -1.158 1.7e-07
ovarian cancer -2.700 2.5e-17
posterior fossa group B ependymoma -1.400 2.2e-10
psoriasis -1.100 4.4e-08

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (24)

AA Sequence

MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKC      1 - 70
TLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVD     71 - 140
LLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELG    141 - 210
HTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKK    211 - 280
ETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLAT    281 - 350
HLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF      351 - 418
//

Text Mined References (35)

PMID Year Title