Property Summary

NCBI Gene PubMed Count 30
Grant Count 1
Funding $34,702
PubMed Score 62.94
PubTator Score 74.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.100 0.000
sonic hedgehog group medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.500 0.000
non-small cell lung cancer -1.158 0.000
colon cancer -1.400 0.043
lung cancer -2.900 0.000
interstitial cystitis -1.600 0.000
posterior fossa group B ependymoma -1.400 0.000
lung carcinoma -1.800 0.000
ovarian cancer -2.700 0.000

Synonym

Accession Q9UNP4 B3KM82 D6W5L9 O94902 Q53QU1 Q6NZX4 Q6YFL1
Symbols SATI
SIAT9
SPDRS
ST3GalV
SIATGM3S

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (20)

PMID Text
26729095 Serum deprivation triggers upregulation of hST3Gal V gene expression through Runx2 activation by BMP signaling in MG-63 cells.
24531716 this study indicated that sialylation involved in the development of MDR of AML cells probably through ST3GAL5 or ST8SIA4 regulating the activity of PI3K/Akt signaling and the expression of P-gp and MRP1.
24026681 Whole-exome sequencing of patients with salt and pepper syndrome shows a homozygous c.994G>A transition (p.E332K) in the ST3GAL5 gene.
22990144 GM3 synthase deficiency, responsible for early-onset epilepsy syndrome, leads to a secondary respiratory chain dysfunction.
21699754 Data demonstrate that valproic acid (VPA) transcriptionally regulates human GM3 synthase (hST3Gal V), which catalyzes ganglioside GM3 biosynthesis in ARPE-19 human retinal pigment epithelial cells.
21571640 GM3 exhibits the potential to regulate the allosteric structural transition from inactive to a signaling EGFR dimer, by preventing the autophosphorylation of the intracellular kinase domain in response to ligand binding
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20219466 In vivo expression of the transcript gives rise to two human ST3Gal-V isoforms with distinct characteristics.
19759399 GM3 synthase overexpression results in reduced cell motility and in caveolin-1 upregulation in human ovarian carcinoma cells
More...

AA Sequence

MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKC      1 - 70
TLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVD     71 - 140
LLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELG    141 - 210
HTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKK    211 - 280
ETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLAT    281 - 350
HLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF      351 - 418
//

Text Mined References (31)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26729095 2015 Serum Deprivation-Induced Human GM3 Synthase (hST3Gal V) Gene Expression Is Mediated by Runx2 in Human Osteoblastic MG-63 Cells.
24531716 2015 Modification of sialylation is associated with multidrug resistance in human acute myeloid leukemia.
24026681 2014 A mutation in a ganglioside biosynthetic enzyme, ST3GAL5, results in salt & pepper syndrome, a neurocutaneous disorder with altered glycolipid and glycoprotein glycosylation.
22990144 2013 Refractory epilepsy and mitochondrial dysfunction due to GM3 synthase deficiency.
21699754 2011 Transcriptional activation of human GM3 synthase (hST3Gal V) gene by valproic acid in ARPE-19 human retinal pigment epithelial cells.
21571640 2011 Regulation of human EGF receptor by lipids.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20219466 2010 Two active and differently N-glycosylated isoforms of human ST3Gal-V are produced from the placental mRNA variant by a leaky scanning mechanism.
More...