Property Summary

NCBI Gene PubMed Count 168
Grant Count 210
R01 Count 121
Funding $32,994,776.7
PubMed Score 519.61
PubTator Score 371.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
astrocytic glioma -1.200 0.041
oligodendroglioma -1.100 0.046
cystic fibrosis 1.030 0.000
atypical teratoid / rhabdoid tumor 2.100 0.024
intraductal papillary-mucinous neoplasm ... 1.400 0.008
gastric carcinoma 1.700 0.014
ductal carcinoma in situ -1.500 0.005
invasive ductal carcinoma -1.400 0.028
ovarian cancer -5.600 0.000

Synonym

Accession Q9UNN8 B2RC04 Q14218 Q6IB56 Q96CB3 Q9ULX1
Symbols CCCA
EPCR
CCD41

Gene

PANTHER Protein Class (1)

PDB

1L8J   1LQV   3JTC   4V3D   4V3E  

 GO Function (1)

Gene RIF (145)

PMID Text
26620701 In this Tanzanian population, neither PROCR haplotype nor level of soluble EPCR was associated with severe malaria.
26119044 Overall, these findings reveal a much greater complexity of how Plasmodium falciparum PfEMP1 CIDRalpha1 domain-expressing parasites may modulate malaria pathogenesis through EPCR adhesion.
26118955 These data reveal a previously unknown functional heterogeneity in the interaction between Plasmodium falciparum PfEMP1 CIDRalpha1domain binding to EPCR and have major implications for understanding the distinct clinical pathologies of cerebral malaria.
26015475 Individuals exposed to high levels of Plasmodium falciparum PfEMP1 acquire antibodies to EPCR-binding CIDR domains early in life.
25895599 This effect of EPCR may be dependent on PAR1.
25667200 Report activation of protein C and down-regulation of EPCR in trophobolasts stimulated with TNF-alpha.
25588409 Serum soluble EPCR is elevated in Alzheimer's disease. The degree of cognitive impairment is significantly correlated with serum sEPCR levels in Alzheimer's disease and mild cognitive impairment patients and healthy controls.
25541704 genetic variation in the PROCR gene in our study population does not influence susceptibility to major severe malaria phenotypes
25425698 It was concluded that measuring EPCR levels at admission could provide an early biological marker of the outcome of cerebral malaria.
25407022 Increased coagulation activity and genetic polymorphisms in the F5, F10 and EPCR genes are associated with breast cancer.
More...

AA Sequence

MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQL      1 - 70
QPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSF     71 - 140
VSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTS    141 - 210
LVLGVLVGSFIIAGVAVGIFLCTGGRRC                                              211 - 238
//

Text Mined References (171)

PMID Year Title
26620701 2015 Haplotypes of the endothelial protein C receptor (EPCR) gene are not associated with severe malaria in Tanzania.
26119044 2015 Diverse functional outcomes of Plasmodium falciparum ligation of EPCR: potential implications for malarial pathogenesis.
26118955 2015 Plasmodium falciparum adhesion domains linked to severe malaria differ in blockade of endothelial protein C receptor.
26015475 2015 IgG antibodies to endothelial protein C receptor-binding cysteine-rich interdomain region domains of Plasmodium falciparum erythrocyte membrane protein 1 are acquired early in life in individuals exposed to malaria.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25895599 2015 Endothelial cell protein C receptor promotes MGC803 gastric cancer cells proliferation and migration by activating ERK1/2.
25667200 2015 Activation of Protein C in Human Trophoblasts in Culture and Downregulation of Trophoblast Endothelial Protein C Receptor by TNF-?.
25588409 2015 Serum sEPCR levels are elevated in patients with Alzheimer's disease.
25541704 2014 Endothelial protein C receptor gene variants not associated with severe malaria in ghanaian children.
25425698 2015 High plasma levels of soluble endothelial protein C receptor are associated with increased mortality among children with cerebral malaria in Benin.
More...