Property Summary

NCBI Gene PubMed Count 181
PubMed Score 540.95
PubTator Score 371.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 4.1e-02
atypical teratoid / rhabdoid tumor 2.100 2.4e-02
cystic fibrosis 1.030 2.5e-05
ductal carcinoma in situ -1.500 5.2e-03
gastric carcinoma 1.700 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 8.0e-03
invasive ductal carcinoma -1.400 2.8e-02
malignant mesothelioma -3.200 1.6e-07
oligodendroglioma -1.100 4.6e-02
ovarian cancer -5.600 8.9e-20

Gene RIF (157)

AA Sequence

MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQL      1 - 70
QPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSF     71 - 140
VSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTS    141 - 210
LVLGVLVGSFIIAGVAVGIFLCTGGRRC                                              211 - 238
//

Text Mined References (184)

PMID Year Title