Property Summary

NCBI Gene PubMed Count 62
PubMed Score 56.52
PubTator Score 53.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.9e-02
glioblastoma 1.300 1.5e-02
group 3 medulloblastoma 1.300 4.4e-02
medulloblastoma, large-cell 2.000 4.7e-04
osteosarcoma 2.495 9.8e-06
ovarian cancer 1.400 4.6e-05

Synonym

Accession Q9UNN5 Q549F0 Q9UF34 Q9UNT3 Q9Y2Z3 hFAF1
Symbols hFAF1
CGI-03
HFAF1s
UBXD12
UBXN3A

Gene

PDB

1H8C   2DZM   2EC4   3E21   3QC8   3QCA   3QQ8   3QWZ   3QX1   3R3M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (40)

AA Sequence

MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPAS      1 - 70
HPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKM     71 - 140
LLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLN    141 - 210
FSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEE    211 - 280
QITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHP    281 - 350
VFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN    351 - 420
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQ    421 - 490
QQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQA    491 - 560
LPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPN    561 - 630
KSLLEVKLFPQETLFLEAKE                                                      631 - 650
//

Text Mined References (69)

PMID Year Title