Property Summary

NCBI Gene PubMed Count 58
Grant Count 5
R01 Count 4
Funding $1,229,440.67
PubMed Score 51.28
PubTator Score 53.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.495 0.000
medulloblastoma 1.500 0.001
atypical teratoid / rhabdoid tumor 1.100 0.019
glioblastoma 1.300 0.015
medulloblastoma, large-cell 2.000 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q9UNN5 Q549F0 Q9UF34 Q9UNT3 Q9Y2Z3 hFAF1
Symbols hFAF1
CGI-03
HFAF1s
UBXD12
UBXN3A

Gene

PDB

1H8C   2DZM   2EC4   3E21   3QC8   3QCA   3QQ8   3QWZ   3QX1   3R3M  

Gene RIF (36)

PMID Text
26842564 Progression of the DNA replication fork is coordinated by FAF1. FAF1 binds to the licensing factor CDT-1 and additional ubiquitylated proteins, thus promoting CDC48-dependent turnover and disassembly of DNA replication factor complexes.
26811330 FAF1 plays a novel role in negatively regulating virus-induced IFN-beta production and the antiviral response by inhibiting the translocation of active, phosphorylated IRF3 from the cytosol to the nucleus
24885147 The repertoire of VAPB interactors is more diverse than previously anticipated and link VAPB to the function of ATPase complexes such as p97/FAF1 and ASNA1/transmembrane-domain recognition complex.
24810049 Report a novel role for FAF1 in regulating CD40-induced NFkappaB activation via a negative feedback loop.
23720822 long-chain unsaturated fatty acids also induced polymerization of Fas-associated factor 1 (FAF1), the only other mammalian protein that contains a UAS domain homologous to that of Ubxd8
23293021 Data indicate that Npl4-Ufd1 heterodimer is required for VCP-FAF1 interaction.
22876279 hFAF1 inhibits tumor formation by increasing the degradation of Hsp70 mediated via its UBA domain.
22730322 Fas-associated factor 1 is a scaffold protein that promotes beta-transducin repeat-containing protein (beta-TrCP)-mediated beta-catenin ubiquitination and degradation.
22102026 Wild-type p97/VCP ND1 in complex with FAF1 UBX crystallized into very thin sheet-shaped crystals which turned out to be of poor diffraction quality
21978668 The authors report the first in vitro confirmed non-homotypic interaction between NLRP12 pyrin domain and the pro-apoptotic protein Fas-associated factor 1 (FAF-1), which links the innate immune system to apoptotic signaling.
More...

AA Sequence

MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPAS      1 - 70
HPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKM     71 - 140
LLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLN    141 - 210
FSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEE    211 - 280
QITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHP    281 - 350
VFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN    351 - 420
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQ    421 - 490
QQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQA    491 - 560
LPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPN    561 - 630
KSLLEVKLFPQETLFLEAKE                                                      631 - 650
//

Text Mined References (65)

PMID Year Title
26842564 2016 Chromatin-associated degradation is defined by UBXN-3/FAF1 to safeguard DNA replication fork progression.
26811330 2016 Fas-Associated Factor 1 Negatively Regulates the Antiviral Immune Response by Inhibiting Translocation of Interferon Regulatory Factor 3 to the Nucleus.
24885147 2014 VAPB/ALS8 interacts with FFAT-like proteins including the p97 cofactor FAF1 and the ASNA1 ATPase.
24810049 2014 Fas-associated factor (Faf1) is a novel CD40 interactor that regulates CD40-induced NF-?B activation via a negative feedback loop.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23720822 2013 UAS domain of Ubxd8 and FAF1 polymerizes upon interaction with long-chain unsaturated fatty acids.
23293021 2013 Complex of Fas-associated factor 1 (FAF1) with valosin-containing protein (VCP)-Npl4-Ufd1 and polyubiquitinated proteins promotes endoplasmic reticulum-associated degradation (ERAD).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22876279 2012 Ubiquitin-associated (UBA) domain in human Fas associated factor 1 inhibits tumor formation by promoting Hsp70 degradation.
22730322 2012 Fas-associated factor 1 is a scaffold protein that promotes ?-transducin repeat-containing protein (?-TrCP)-mediated ?-catenin ubiquitination and degradation.
More...