Property Summary

NCBI Gene PubMed Count 49
PubMed Score 11.86
PubTator Score 9.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
psoriasis 6694 5.0e-05
Multiple myeloma 1332 1.1e-04
ovarian cancer 8520 1.4e-04
osteosarcoma 7950 2.0e-04
Disease Target Count Z-score Confidence
Leber congenital amaurosis 69 3.165 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.567 1.1e-04
osteosarcoma -1.446 2.0e-04
ovarian cancer 1.900 1.4e-04
psoriasis -2.100 5.0e-05

PDB (15)

Gene RIF (28)

AA Sequence

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHR      1 - 70
VNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEE     71 - 140
MLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGV    141 - 210
FNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEM    211 - 280
TFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMK    281 - 350
DRLEFWCTDVKSMEMLVEHQAHDILT                                                351 - 376
//

Text Mined References (56)

PMID Year Title