Property Summary

NCBI Gene PubMed Count 49
PubMed Score 11.86
PubTator Score 9.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
psoriasis 6694 5.0e-05
Multiple myeloma 1332 1.1e-04
ovarian cancer 8520 1.4e-04
osteosarcoma 7950 2.0e-04
Disease Target Count Z-score Confidence
Leber congenital amaurosis 69 3.165 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.567 1.1e-04
osteosarcoma -1.446 2.0e-04
ovarian cancer 1.900 1.4e-04
psoriasis -2.100 5.0e-05

Synonym

Accession Q9UNM6 B3KT15 O75831 Q53XU2 Q9UNV3
Symbols S11
Rpn9
p40.5
HSPC027

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   5L4K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (28)

AA Sequence

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHR      1 - 70
VNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEE     71 - 140
MLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGV    141 - 210
FNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEM    211 - 280
TFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMK    281 - 350
DRLEFWCTDVKSMEMLVEHQAHDILT                                                351 - 376
//

Text Mined References (56)

PMID Year Title