Property Summary

NCBI Gene PubMed Count 71
Grant Count 23
R01 Count 10
Funding $2,723,036.24
PubMed Score 63.88
PubTator Score 87.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.492 1.7

Expression

Gene RIF (59)

PMID Text
26544625 Data show that Ras protein regulates inhibitor of growth protein 4 (ING4)-thymine-DNA glycosylase (TDG)-Fas protein axis to promote apoptosis resistance in pancreatic cancer.
26278569 MiR-761 directly targeted ING4 and TIMP2.
25968091 This review summarizes the recent published literature that investigates the role of ING4 in regulating tumorigenesis and progression, and explores its potential for cancer treatment. [review]
25792601 SCF(JFK) as a bona fide E3 ligase for ING4 and unraveled the JFK-ING4-NF-kappaB axis as an important player in the development and progression of breast cancer
25790869 Data suggest a close connection between aberrant ING4 expression and the carcinogenesis of human bladder cells.
25571952 The enhanced antitumor activity generated by Ad.RGD-ING4-PTEN was closely associated with activation of the intrinsic and extrinsic apoptotic pathways and additive inhibition of tumor angiogenesis both in vitro and in vivo.
25490312 work suggests that ING4 can suppress osteosarcoma progression through signaling pathways such as mitochondria pathway and NF-kappaB signaling pathway and ING4 gene therapy is a promising approach to treating osteosarcoma.
24762396 loss of ING4, either directly or indirectly through loss of Pten, promotes Myc-driven prostate oncogenesis.
24157826 JWA has an important role in ING4-regulated melanoma angiogenesis, and ING4/JWA/ILK are promising prognostic markers and may be used as anti-angiogenic therapeutic targets for melanoma.
24130172 KAI1 overexpression increases ING4 expression in melanoma.
More...

AA Sequence

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE      1 - 70
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA     71 - 140
ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI    141 - 210
GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK                                   211 - 249
//

Text Mined References (74)

PMID Year Title
26544625 2015 Oncogenic Ras suppresses ING4-TDG-Fas axis to promote apoptosis resistance.
26278569 2015 MiR-761 Promotes Progression and Metastasis of Non-Small Cell Lung Cancer by Targeting ING4 and TIMP2.
25968091 2015 The emerging role of inhibitor of growth 4 as a tumor suppressor in multiple human cancers.
25792601 2015 SCF(JFK) is a bona fide E3 ligase for ING4 and a potent promoter of the angiogenesis and metastasis of breast cancer.
25790869 2015 Reduced ING4 Expression Is Associated with the Malignancy of Human Bladder.
25571952 2015 Adenovirus-mediated ING4/PTEN double tumor suppressor gene co-transfer modified by RGD enhances antitumor activity in human nasopharyngeal carcinoma cells.
25490312 2014 Delivery of inhibitor of growth 4 (ING4) gene significantly inhibits proliferation and invasion and promotes apoptosis of human osteosarcoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
24762396 2014 Transient induction of ING4 by Myc drives prostate epithelial cell differentiation and its disruption drives prostate tumorigenesis.
24157826 2013 ING4 regulates JWA in angiogenesis and their prognostic value in melanoma patients.
More...