Property Summary

NCBI Gene PubMed Count 78
PubMed Score 69.34
PubTator Score 87.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Lymphatic Metastasis 15 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2499 3.571 1.8

Expression

Gene RIF (66)

AA Sequence

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE      1 - 70
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA     71 - 140
ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI    141 - 210
GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK                                   211 - 249
//

Text Mined References (81)

PMID Year Title