Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.86
PubTator Score 4.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer 1.900 4.9e-02
cystic fibrosis 1.016 4.0e-05
intraductal papillary-mucinous adenoma (... -1.100 2.9e-03
intraductal papillary-mucinous carcinoma... -1.400 3.2e-03
juvenile dermatomyositis 1.138 3.7e-07
medulloblastoma, large-cell 1.100 2.9e-04
Multiple myeloma 2.197 5.8e-04
osteosarcoma 1.627 1.1e-03
ovarian cancer -1.200 7.4e-05
pancreatic cancer -1.200 3.1e-03
pancreatic ductal adenocarcinoma liver m... -1.228 1.9e-02
pituitary cancer -1.200 2.1e-08
spina bifida -1.937 2.7e-02
type II diabetes mellitus and post-ische... -1.200 3.7e-02
ulcerative colitis 1.100 6.3e-06

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVST      1 - 70
YLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFY     71 - 140
NNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK                             141 - 185
//

Text Mined References (21)

PMID Year Title