Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.68
PubTator Score 4.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UNL2 B2R7D0 B4E2P2 D3DNK5 Q549M4 TRAP-gamma
Symbols TRAPG

Gene

Gene RIF (3)

PMID Text
23660295 translocon-associated protein subunit gamma (TRAPgamma) was identified as a novel TR3 binding partner.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides upregulate gene expression of signal sequence receptor, gamma (translocon-associated protein gamma; SSR3) in U-937 macrophages
18976975 Knockdown of signal sequence receptor, gamma (translocon-associated protein gamma; SSR3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVST      1 - 70
YLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFY     71 - 140
NNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK                             141 - 185
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23660295 2013 The orphan nuclear receptor TR3/Nur77 regulates ER stress and induces apoptosis via interaction with TRAP?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...