Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.98
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma 1.100 0.018
osteosarcoma -1.019 0.000
primary pancreatic ductal adenocarcinoma -1.383 0.002
lung cancer 1.300 0.005
pancreatic cancer -1.400 0.005

Synonym

Accession Q9UNK9 B4DWL7 O94859 Q8NCS9
Symbols Ccr4e
KIAA0759

Gene

AA Sequence

MIASCLCYLLLPATRLFRALSDAFFTCRKNVLLANSSSPQVEGDFAMAPRGPEQEECEGLLQQWREEGLS      1 - 70
QVLSTASEGPLIDKGLAQSSLALLMDNPGEENAASEDRWSSRQLSDLRAAENLDEPFPEMLGEEPLLEVE     71 - 140
GVEGSMWAAIPMQSEPQYADCAALPVGALATEQWEEDPAVLAWSIAPEPVPQEEASIWPFEGLGQLQPPA    141 - 210
VEIPYHEILWREWEDFSTQPDAQGLKAGDGPQFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFV    211 - 280
NLMQEFQHWDPDILCLQEVQEDHYWEQLEPSLRMMGFTCFYKRRTGCKTDGCAVCYKPTRFRLLCASPVE    281 - 350
YFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAILLAEVDKVARL    351 - 420
SDGSHCPIILCGDLNSVPDSPLYNFIRDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDC    421 - 490
CQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAESVLEEDASELEPA    491 - 560
FSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTDHRLYRDGTLKLL    561 - 630
GRLSLLSEEILWAANGLPNPFCSSDHLCLLASFGMEVTAP                                  631 - 670
//

Text Mined References (10)

PMID Year Title
23814182 2013 Tracking a refined eIF4E-binding motif reveals Angel1 as a new partner of eIF4E.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943475 2002 Genomic structure and evolutionary context of the human feline leukemia virus subgroup C receptor (hFLVCR) gene: evidence for block duplications and de novo gene formation within duplicons of the hFLVCR locus.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.