Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.15
PubTator Score 1.75

Knowledge Summary


No data available


  Disease (3)


  Differential Expression (5)

Disease log2 FC p
lung cancer 1.300 4.7e-03
oligodendroglioma 1.100 1.8e-02
osteosarcoma -1.019 9.0e-05
pancreatic cancer -1.400 5.3e-03
primary pancreatic ductal adenocarcinoma -1.383 2.0e-03


Accession Q9UNK9 B4DWL7 O94859 Q8NCS9
Symbols Ccr4e


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

GRLSLLSEEILWAANGLPNPFCSSDHLCLLASFGMEVTAP                                  631 - 670

Text Mined References (10)

PMID Year Title