Property Summary

Ligand Count 10
NCBI Gene PubMed Count 25
PubMed Score 139.26
PubTator Score 68.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 4.3e-02
interstitial cystitis 1.800 1.6e-02
ovarian cancer 1.100 3.3e-07
psoriasis 2.500 1.7e-22

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCC      1 - 70
YDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRG     71 - 140
QTPGC                                                                     141 - 145
//

Text Mined References (27)

PMID Year Title