Property Summary

NCBI Gene PubMed Count 25
Grant Count 53
R01 Count 34
Funding $4,156,863.29
PubMed Score 121.44
PubTator Score 68.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 0.043
interstitial cystitis 1.800 0.016
ovarian cancer 1.100 0.000
psoriasis 2.500 0.000

Gene RIF (17)

PMID Text
26392224 found to induce PLA2G2D expression in mice and in human monocyte-derived macrophages
22490726 phospholipid bilayer permeabilization by the hsPLA2GIID is independent of catalytic activity.
22240557 sPLA(2)-IID is present at the head and midpiece in the human sperm, and its activation seems to be involved in acrosomal exocytosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19365107 The Gly80Ser polymorphism may be associated with the body weight loss seen in chronic obstructive pulmonary disease patients. PLA2G2D-Ser enhances the expression of IL-6 and IL-8 compared with PLA2G2D-Gly.
18958346 The distribution pattern of sPLA2S in intact spermatozoa might be an additional parameter for evaluating sperm quality
16897354 lipopolysaccharides inhibit interferon gamma-induced gene expression of secretory phospholipase A2 type IID in human monocyte-derived macrophages
16002569 Observational study of gene-disease association. (HuGE Navigator)
16002569 These results suggest that sPLA2-IID may be one of the susceptibility genes that contribute to body weight loss in patients with COPD.
More...

AA Sequence

MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCC      1 - 70
YDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRG     71 - 140
QTPGC                                                                     141 - 145
//

Text Mined References (27)

PMID Year Title
26392224 2015 Critical role of phospholipase A2 group IID in age-related susceptibility to severe acute respiratory syndrome-CoV infection.
23533611 2013 Assessing phospholipase A2 activity toward cardiolipin by mass spectrometry.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22490726 2012 The bactericidal effect of human secreted group IID phospholipase A2 results from both hydrolytic and non-hydrolytic activities.
22240557 Secretory phospholipase A2 group IID Is involved in progesterone-induced acrosomal exocytosis of human spermatozoa.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19365107 2009 Gly80Ser polymorphism of phospholipase A2-IID is associated with cytokine inducibility in A549 cells.
18958346 2008 Destabilization of acrosome and elastase influence mediate the release of secretory phospholipase A2 from human spermatozoa.
18405237 2008 Biochemistry and physiology of mammalian secreted phospholipases A2.
More...