Property Summary

NCBI Gene PubMed Count 26
PubMed Score 391.54
PubTator Score 259.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.300 5.0e-04
intraductal papillary-mucinous neoplasm ... -1.100 9.7e-03
medulloblastoma, large-cell -1.600 9.5e-05
ovarian cancer -1.700 4.5e-09
tuberculosis 2.200 1.9e-10

Gene RIF (16)

AA Sequence

MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQ      1 - 70
ITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEI     71 - 140
RQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRK    141 - 210
SASCGMIMVILLLLVAIVVVAVWPTN                                                211 - 236
//

Text Mined References (28)

PMID Year Title