Property Summary

NCBI Gene PubMed Count 26
Grant Count 50
R01 Count 15
Funding $7,787,645.14
PubMed Score 375.21
PubTator Score 259.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.600 0.000
tuberculosis 2.200 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.010
group 4 medulloblastoma -1.300 0.001
ovarian cancer -1.700 0.000

Gene RIF (16)

PMID Text
27094127 Stx8 is required for proper and timely sorting and trafficking of cytotoxic molecules to functional lytic granules through the endosomal pathway in human cytotoxic t-lymphocytes.
25523146 Increased STX8 expression in visceral adipose tissue appears to be associated with the presence of type 2 diabetes in obese patients through a mechanism that may involve GLUT4.
25404741 Syntaxin 8 has a role in regulating platelet dense granule secretion, aggregation, and thrombus stability
24743596 Syntaxin-8 regulates the endocytosis of TASK-1.
24659781 These results suggest that STX8 mediates the recycling of CLDN16 and constitutes an important component of the CLDN16 trafficking machinery in the kidney.
22875976 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntaxin 8
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein syntaxin 8
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQ      1 - 70
ITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEI     71 - 140
RQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRK    141 - 210
SASCGMIMVILLLLVAIVVVAVWPTN                                                211 - 236
//

Text Mined References (28)

PMID Year Title
27094127 2016 Syntaxin 8 is required for efficient lytic granule trafficking in cytotoxic T lymphocytes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25523146 2015 Expression of syntaxin 8 in visceral adipose tissue is increased in obese patients with type 2 diabetes and related to markers of insulin resistance and inflammation.
25416956 2014 A proteome-scale map of the human interactome network.
25404741 2015 Syntaxin 8 regulates platelet dense granule secretion, aggregation, and thrombus stability.
24743596 2014 Cooperative endocytosis of the endosomal SNARE protein syntaxin-8 and the potassium channel TASK-1.
24659781 2014 Tight junctional localization of claudin-16 is regulated by syntaxin 8 in renal tubular epithelial cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
More...