Property Summary

Ligand Count 8
NCBI Gene PubMed Count 18
PubMed Score 259.78
PubTator Score 213.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.073 2.1e-06

Gene RIF (11)

AA Sequence

MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKT      1 - 70
FRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILA     71 - 140
NNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPL    141 - 210
HCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN                          211 - 258
//

Text Mined References (20)

PMID Year Title