Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $253,589.34
PubMed Score 10.24
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q9UNH7 C0H5W9 Q9Y449
Symbols TFAF2
MSTP010

Gene

 Grant Application (2)

Gene RIF (6)

PMID Text
25535984 These results identify SNX6 as a key regulator of lamin A synthesis and incorporation into the nuclear envelope.
25496667 Genome-wide shRNA screening identifies SNX6, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20830743 Study observed that SNX6 increases BRMS1-dependent transcriptional repression. Moreover, over-expression of SNX6 was capable of diminishing trans-activation in a dose-dependent manner.
20354142 SNX6 modulates the retrograde trafficking and basal levels of BACE1, thereby regulating BACE1-mediated APP processing and Abeta biogenesis
19935774 These observations indicate that in addition to SNX1/2, SNX6 in association with the dynein/dynactin complex drives the formation and movement of tubular retrograde intermediates.
17148574 SNX5 and SNX6 may constitute functional equivalents of Vps17p in mammalian retromer

AA Sequence

MMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQH      1 - 70
EEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKT     71 - 140
VAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFF    141 - 210
EHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKI    211 - 280
EARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQK    281 - 350
FEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT                  351 - 406
//

Text Mined References (30)

PMID Year Title
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
26172538 2015 Retromer Ensures the Degradation of Autophagic Cargo by Maintaining Lysosome Function in Drosophila.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25535984 2014 Sorting nexin 6 enhances lamin a synthesis and incorporation into the nuclear envelope.
24610942 2014 Isoform 5 of PIPKI? regulates the endosomal trafficking and degradation of E-cadherin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
More...