Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.14
PubTator Score 3.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

AA Sequence

MDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSRGEFDSSEFEV      1 - 70
RRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDF     71 - 140
KIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRI    141 - 210
YKEEREYFDEMKEYGPIHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEM    211 - 280
LMGVMKRRDQIQAELDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFT    281 - 350
DMAEENIHYYEQCLATWESFLTSQTNLHLEEASEDKP                                     351 - 387
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
20203127 2010 Do GnRH analogues directly affect human endometrial epithelial cell gene expression?
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...