Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.14
PubTator Score 3.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Duchenne muscular dystrophy 602 1.92234496558843E-8
malignant mesothelioma 3163 3.41498321096997E-8
Amyotrophic Lateral Sclerosis 432 1.03782579760061E-6
group 4 medulloblastoma 1875 3.95297582191451E-5
limb girdle muscular dystrophy 2A 156 7.22672326085655E-5
glioblastoma 5572 8.33447293994715E-5
osteosarcoma 7933 2.95517517000601E-4
ovarian cancer 8492 3.07811990983255E-4
interstitial cystitis 2299 3.21246701317909E-4
Becker muscular dystrophy 187 4.11984879585753E-4
medulloblastoma, large-cell 6234 0.001489281983685
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00251196328545871
psoriasis 6685 0.00507484468806361
lung cancer 4473 0.0188334892454786
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 2.0
Disease Target Count Z-score Confidence
Hiatus hernia 7 3.374 1.7
Bipolar Disorder 266 3.05 1.5

Expression

  Differential Expression (14)

Gene

PDB

3IQ2  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSRGEFDSSEFEV      1 - 70
RRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDF     71 - 140
KIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRI    141 - 210
YKEEREYFDEMKEYGPIHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEM    211 - 280
LMGVMKRRDQIQAELDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFT    281 - 350
DMAEENIHYYEQCLATWESFLTSQTNLHLEEASEDKP                                     351 - 387
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
20203127 2010 Do GnRH analogues directly affect human endometrial epithelial cell gene expression?
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...