Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.55
PubTator Score 3.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.552 1.0e-06
autosomal dominant Emery-Dreifuss muscul... 2.019 2.5e-03
Becker muscular dystrophy 1.192 4.1e-04
Duchenne muscular dystrophy 1.614 1.9e-08
glioblastoma 1.500 8.3e-05
group 4 medulloblastoma -2.400 4.0e-05
interstitial cystitis -1.200 3.2e-04
limb girdle muscular dystrophy 2A 1.401 7.2e-05
lung cancer 1.500 1.9e-02
malignant mesothelioma -2.500 3.4e-08
medulloblastoma, large-cell -2.400 1.5e-03
osteosarcoma 2.076 3.0e-04
ovarian cancer -2.300 4.9e-05
psoriasis 1.200 5.1e-03

Gene RIF (1)

AA Sequence

MDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSRGEFDSSEFEV      1 - 70
RRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDF     71 - 140
KIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRI    141 - 210
YKEEREYFDEMKEYGPIHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEM    211 - 280
LMGVMKRRDQIQAELDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFT    281 - 350
DMAEENIHYYEQCLATWESFLTSQTNLHLEEASEDKP                                     351 - 387
//

Text Mined References (18)

PMID Year Title