Property Summary

NCBI Gene PubMed Count 35
PubMed Score 210.17
PubTator Score 70.54

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 7.40975228434687E-16
lung adenocarcinoma 2714 3.04313902889785E-14
ulcerative colitis 2087 9.76811798437226E-10
osteosarcoma 7933 6.99580156162249E-9
Breast cancer 3099 1.0050852287998E-7
malignant mesothelioma 3163 1.60299680254848E-5
medulloblastoma, large-cell 6234 9.40060121199984E-5
colon cancer 1475 3.9060641107033E-4
gastric cancer 436 4.26929279770955E-4
psoriasis 6685 4.99226159143027E-4
Endometriosis 535 0.00827341942959581
lung cancer 4473 0.0282282671981883
chronic rhinosinusitis 512 0.0328399349308848
Rheumatoid Arthritis 1171 0.041150327272496
Disease Target Count Z-score Confidence
Nonsyndromic deafness 121 0.0 4.0
Disease Target Count Z-score Confidence
cartilage-hair hypoplasia 7 3.335 1.7


  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.041
gastric cancer 1.300 0.000
malignant mesothelioma -1.700 0.000
psoriasis -1.700 0.000
osteosarcoma -3.096 0.000
medulloblastoma, large-cell 1.300 0.000
lung cancer -1.300 0.028
colon cancer -1.500 0.000
lung adenocarcinoma -1.100 0.000
Endometriosis -1.327 0.008
Breast cancer -2.000 0.000
ulcerative colitis -2.500 0.000
ovarian cancer -1.700 0.000
chronic rhinosinusitis -1.397 0.033


Accession Q9UNH5 A6MA65 B1AQ14 B1AQ15 O43171 O60727 O60728 Q52LH9 Q8IXX0
Symbols cdc14


  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (21)

26747605 hCDC14A is down-regulated in many tumor tissues and reduced hCDC14A expression is correlated with poorer survival of patients with cancer
25503649 These findings indicated that ZIPK may also be involved in the regulation of the cell cycle in human cells, by interacting with HsCdc14A.
25463242 hCdc14A might be involved in cell cycle regulation in cultured human brain vascular endothelial cells during high glucose-, free fatty acids-, and hypoxia-induced injury.
23051732 These data support the hypothesis that Cdc14A counteracts Cdk1-cyclin B1 activity through Wee1 dephosphorylation.
22784093 CDC (cell division cycle) 14A/B phosphatases associate with KIBRA, and CDK1-non-phosphorylatable KIBRA has greatly reduced interaction with CDC14B.
21233601 Cdc14 phosphatase plays a role in cell cycle control in higher eukaryotes.
20956543 Cdc14A phosphatase prevents premature activation of Cdk1 regulating Cdc25A and Cdc25B at the entry into mitosis.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20479464 human HCT116, and human telomerase reverse transcription-immortalized retinal pigment epithelial cells deleted for Cdc14A are DNA damage checkpoint proficient and arrest efficiently in G2 in response to irradiation.
20477815 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

HTTILRPSYTGLSSSSARFLSRSIPSLQSEYVHY                                        561 - 594

Text Mined References (39)

PMID Year Title
27259055 2016 Mutations in CDC14A, Encoding a Protein Phosphatase Involved in Hair Cell Ciliogenesis, Cause Autosomal-Recessive Severe to Profound Deafness.
26747605 2016 Human phosphatase CDC14A is recruited to the cell leading edge to regulate cell migration and adhesion.
25503649 2015 Zipper-interacting protein kinase interacts with human cell division cycle 14A phosphatase.
25463242 2015 HCdc14A is involved in cell cycle regulation of human brain vascular endothelial cells following injury induced by high glucose, free fatty acids and hypoxia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23051732 2012 Human Cdc14A regulates Wee1 stability by counteracting CDK-mediated phosphorylation.
22784093 2012 Phospho-regulation of KIBRA by CDK1 and CDC14 phosphatase controls cell-cycle progression.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21233601 2011 Human Cdc14A becomes a cell cycle gene in controlling Cdk1 activity at the G?/M transition.
20956543 2010 Human Cdc14A phosphatase modulates the G2/M transition through Cdc25A and Cdc25B.