Property Summary

NCBI Gene PubMed Count 36
PubMed Score 216.35
PubTator Score 70.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -1.600 1.9e-06
chronic rhinosinusitis -1.397 3.3e-02
colon cancer -1.500 3.9e-04
Endometriosis -1.327 8.3e-03
gastric cancer 1.300 4.3e-04
lung adenocarcinoma -1.100 3.0e-14
lung cancer -1.300 2.8e-02
malignant mesothelioma -1.700 1.6e-05
medulloblastoma, large-cell 1.300 9.4e-05
osteosarcoma -3.096 7.0e-09
ovarian cancer -1.500 3.8e-07
psoriasis -1.700 5.0e-04
Rheumatoid arthritis 1.200 4.1e-02
ulcerative colitis -2.500 9.8e-10

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKK      1 - 70
LKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYN     71 - 140
LTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPE    141 - 210
AYFPYFKKHNVTAVVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKA    211 - 280
GLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEG    281 - 350
SINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDD    351 - 420
TKGHPRAVSQPFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNA    421 - 490
ATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPELNNNQYNRSSNSNGGNLNSPPGPHSAKTEE    491 - 560
HTTILRPSYTGLSSSSARFLSRSIPSLQSEYVHY                                        561 - 594
//

Text Mined References (40)

PMID Year Title