Property Summary

NCBI Gene PubMed Count 47
PubMed Score 62.77
PubTator Score 47.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.4e-11
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 1.4
Crohn's disease 321 0.0 2.4

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 8.4e-11

 CSPA Cell Line (2)

Gene RIF (35)

AA Sequence

MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIF      1 - 70
LQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLY     71 - 140
KNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS               141 - 199
//

Text Mined References (49)

PMID Year Title