Property Summary

NCBI Gene PubMed Count 45
Grant Count 25
R01 Count 4
Funding $1,441,688.07
PubMed Score 58.39
PubTator Score 47.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

Gene RIF (33)

PMID Text
25429429 An increase in GITRL may impair the balance of Th17/Treg, and contribute to the pathopoiesis of Hashimoto's thyroiditis.
23935647 Our findings indicate the possible involvement of GITR-GITRL pathway in the pathogenesis of pSS.
23251213 Serum GITRL levels were higher in SLE patients.
22649191 Glucocorticoid-induced TNF-related ligand (GITRL) confers pseudoexpression to tumor cells by platelets, which results in GITRL expression by megakaryocytes and their platelet progeny.
22417213 observation suggests a link between cytokine-regulated keratinocyte GITRL expression and its role in inflammatory responses in AD
22112394 GITRL upregulation induced by IFN-beta on dendritic cells downregulates CTLA-4 on regulatory T (Treg) cells, facilitating proliferation of anergic Treg cells in multiple sclerosis treatment of multiple sclerosis patients.
21705620 Although GITR transgene costimulation can therapeutically enhance T helper (Th) type 2 cell responses, GITR-GITR ligand interactions are not required for development of Th2-mediated resistance or pathology.
21693309 GITRL expression on Kupffer cells may mediate acute rejection in liver transplantation
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIF      1 - 70
LQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLY     71 - 140
KNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS               141 - 199
//

Text Mined References (47)

PMID Year Title
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
25429429 2014 Th17/Treg cells imbalance and GITRL profile in patients with Hashimoto's thyroiditis.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
23935647 2013 Correlation of increased blood levels of GITR and GITRL with disease severity in patients with primary Sjögren's syndrome.
23892569 2013 Glucocorticoid-induced tumor necrosis factor receptor family-related ligand triggering upregulates vascular cell adhesion molecule-1 and intercellular adhesion molecule-1 and promotes leukocyte adhesion.
23251213 2012 Correlation of circulating glucocorticoid-induced TNFR-related protein ligand levels with disease activity in patients with systemic lupus erythematosus.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22649191 2012 GITR ligand provided by thrombopoietic cells inhibits NK cell antitumor activity.
22417213 2012 Induction of GITRL expression in human keratinocytes by Th2 cytokines and TNF-?: implications for atopic dermatitis.
22112394 2012 IFN-? induces the proliferation of CD4+CD25+Foxp3+ regulatory T cells through upregulation of GITRL on dendritic cells in the treatment of multiple sclerosis.
More...