Property Summary

NCBI Gene PubMed Count 201
PubMed Score 926.79
PubTator Score 75.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.8e-07
diabetes mellitus -1.100 2.8e-03
group 4 medulloblastoma -1.100 1.0e-07
medulloblastoma, large-cell -1.200 2.9e-05
ovarian cancer 1.900 8.7e-06
primitive neuroectodermal tumor -1.100 6.5e-05

Protein-protein Interaction (1)

Gene RIF (142)

AA Sequence

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY      1 - 70
LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALR     71 - 140
IAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMAD    141 - 210
MDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL    211 - 280
IPNLAMKEVIDAFISENGWVEDY                                                   281 - 303
//

Text Mined References (218)

PMID Year Title