Property Summary

NCBI Gene PubMed Count 180
Grant Count 806
R01 Count 492
Funding $137,832,975.64
PubMed Score 813.46
PubTator Score 75.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.300 0.000
primitive neuroectodermal tumor -1.200 0.000
diabetes mellitus -1.100 0.003
ovarian cancer 2.500 0.000

Synonym

Accession Q9UNE7 A2IDB9 O60526 Q969U2 Q9HBT1
Symbols CHIP
UBOX1
SCAR16
HSPABP2
NY-CO-7
SDCCAG7

Gene

PANTHER Protein Class (1)

PDB

4KBQ  

Gene RIF (124)

PMID Text
26900751 CHIP is a bona fide negative regulator of the RIPK1-RIPK3 necrosome formation leading to desensitization of TNF-mediated necroptosis
26658161 Data show that the E3 ubiquitin ligase CHIP interacts with protein arginine methyltransferase-5 (PRMT5) both in vivo and in vitro.
26330542 Protein-protein interactions modulate the docking-dependent E3-ubiquitin ligase activity of CHIP.
26321754 CHIP is required for protein quality control (PQC) and CHIP knockdown diminished cellular PQC capacity in lens cells.
26232501 These results indicate that CHIP decreases the Kv1.5 protein level and functional channel by facilitating its degradation in concert with chaperone Hsc70
26219223 Data suggest that CHIP plays roles in the regulation of autophagic flux.
26206088 Cdk5-mediated phosphorylation of CHIP negatively regulates its neuroprotective function, thereby contributing to neuronal cell death progression following neurotoxic stimuli.
26021863 Our findings demonstrate for the first time that CHIP may be involved in RCC angiogenesis through regulating VEGF secretion and expression of VEGFR2.
26010904 detailed and systematic investigation to characterize if there are significant differences in the CHIP in vitro ubiquitination of human Hsp70 and Hsc70.
25987026 High expression of CHIP is associated with HBV-related Hepatocellular Carcinoma.
More...

AA Sequence

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY      1 - 70
LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALR     71 - 140
IAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMAD    141 - 210
MDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL    211 - 280
IPNLAMKEVIDAFISENGWVEDY                                                   281 - 303
//

Text Mined References (197)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26900751 2016 CHIP controls necroptosis through ubiquitylation- and lysosome-dependent degradation of RIPK3.
26658161 2016 The E3 ubiquitin ligase CHIP mediates ubiquitination and proteasomal degradation of PRMT5.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26330542 2015 Protein-Protein Interactions Modulate the Docking-Dependent E3-Ubiquitin Ligase Activity of Carboxy-Terminus of Hsc70-Interacting Protein (CHIP).
26321754 2015 CHIP Knockdown Reduced Heat Shock Response and Protein Quality Control Capacity in Lens Epithelial Cells.
26232501 2015 E3 ligase CHIP and Hsc70 regulate Kv1.5 protein expression and function in mammalian cells.
26219223 2015 Regulation of autophagic flux by CHIP.
26206088 2016 Phosphorylation of CHIP at Ser20 by Cdk5 promotes tAIF-mediated neuronal death.
26021863 2015 Decreased expression of CHIP leads to increased angiogenesis via VEGF-VEGFR2 pathway and poor prognosis in human renal cell carcinoma.
More...