Property Summary

NCBI Gene PubMed Count 22
PubMed Score 23.00
PubTator Score 15.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.175 9.8e-04
intraductal papillary-mucinous carcinoma... -1.100 5.7e-04
intraductal papillary-mucinous neoplasm ... -1.200 3.2e-03
invasive ductal carcinoma -1.600 7.3e-03
malignant mesothelioma -1.500 3.8e-07
non-small cell lung cancer -1.220 9.8e-09
osteosarcoma -3.374 2.4e-07
pancreatic cancer -1.200 1.7e-03
pancreatic ductal adenocarcinoma liver m... -1.309 1.2e-03
pituitary cancer -1.900 6.4e-05
psoriasis -3.000 2.5e-04

Gene RIF (5)

AA Sequence

MADTIFGSGNDQWVCPNDRQLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQ      1 - 70
QRIGRLVERLETMRRNVMGNGLSQCLLCGEVLGFLGSSSVFCKDCRKKVCTKCGIEASPGQKRPLWLCKI     71 - 140
CSEQREVWKRSGAWFYKGLPKYILPLKTPGRADDPHFRPLPTEPAEREPRSSETSRIYTWARGRVVSSDS    141 - 210
DSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGSVEAPRMGFTHPPGHLSGCQSSLASGETGTGSADPP    211 - 280
GGPRPGLTRRAPVKDTPGRAPAADAAPAGPSSCLG                                       281 - 315
//

Text Mined References (22)

PMID Year Title