Property Summary

NCBI Gene PubMed Count 22
Grant Count 7
R01 Count 4
Funding $220,780.6
PubMed Score 23.08
PubTator Score 15.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26070152 genetic alterations in RPH3AL are associated with aggressive behavior of breast cancers and with short survival of patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17981610 Observational study of gene-disease association. (HuGE Navigator)
15003533 Noc2 may function as a Rab3B effector protein in epithelial cells.
12375017 Mutations of rabphillin-3A-like gene is associated with colorectal cancers

AA Sequence

MADTIFGSGNDQWVCPNDRQLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQ      1 - 70
QRIGRLVERLETMRRNVMGNGLSQCLLCGEVLGFLGSSSVFCKDCRKKVCTKCGIEASPGQKRPLWLCKI     71 - 140
CSEQREVWKRSGAWFYKGLPKYILPLKTPGRADDPHFRPLPTEPAEREPRSSETSRIYTWARGRVVSSDS    141 - 210
DSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGSVEAPRMGFTHPPGHLSGCQSSLASGETGTGSADPP    211 - 280
GGPRPGLTRRAPVKDTPGRAPAADAAPAGPSSCLG                                       281 - 315
//

Text Mined References (22)

PMID Year Title
26070152 2015 Clinical Implications of Rabphillin-3A-Like Gene Alterations in Breast Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19212825 2009 Immunohistochemical expression of rabphilin-3A-like (Noc2) in normal and tumor tissues of human endocrine pancreas.
17981610 2008 Clinical significance of a novel single nucleotide polymorphism in the 5' untranslated region of the Rabphillin-3A-Like gene in colorectal adenocarcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15159548 2004 Noc2 is essential in normal regulation of exocytosis in endocrine and exocrine cells.
More...