Property Summary

NCBI Gene PubMed Count 47
PubMed Score 161.29
PubTator Score 101.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 1.7e-37
interstitial cystitis 2312 2.0e-03
lung cancer 4740 3.8e-03
colon cancer 1478 4.2e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 3.0
Disease Target Count Z-score Confidence
Hypohidrotic ectodermal dysplasia 15 7.594 3.8

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.800 4.2e-02
interstitial cystitis -1.700 2.0e-03
lung cancer 1.200 3.8e-03
psoriasis -1.400 1.7e-37

Protein-protein Interaction (1)

Gene RIF (30)

AA Sequence

MAHVGDCTQTPWLPVLVVSLMCSARAEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYG      1 - 70
CVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLL     71 - 140
APPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATALIIAMSTIFIMAIAIVLIIMFYI    141 - 210
LKTKPSAPACCTSHPGKSVEAQVSKDEEKKEAPDNVVMFSEKDEFEKLTATPAKPTKSENDASSENEQLL    211 - 280
SRSVDSDEEPAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGVVEGLSPTELPF    281 - 350
DCLEKTSRMLSSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIER    351 - 420
LDAVESLCADILEWAGVVPPASQPHAAS                                              421 - 448
//

Text Mined References (51)

PMID Year Title