Property Summary

NCBI Gene PubMed Count 5
Grant Count 10
R01 Count 10
Funding $1,633,260
PubMed Score 90.36
PubTator Score 24.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Sleep apnea 7 3.556 1.8

Expression

Gene RIF (2)

PMID Text
22082156 Knockdown of nuclear pore complex interacting protein (NPIP) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
19460752 Knockdown of nuclear pore complex interacting protein (NPIP) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MFCCLGYEWLSGGCKTWHSAWVINTLADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCTSYLCVSFLKT      1 - 70
IFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKR     71 - 140
KTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYRCKITPSARKP    141 - 210
LCNRVRMAAVEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSIIDNSLSLKTPSECLLTPLPPSALP    211 - 280
SADDNLKTPAECLLYPLPPSADDNLKTPPECLLTPLPPSAPPSVDDNLKTPPECVCSLPFHPQRMIISRN    281 - 350
//

Text Mined References (6)

PMID Year Title
18055785 2007 Novel retinal and cone photoreceptor transcripts revealed by human macular expression profiling.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11586358 2001 Positive selection of a gene family during the emergence of humans and African apes.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
1158635 1975 Effects of lysophosphatidyl choline and phospholipase A on the lens.