Property Summary

NCBI Gene PubMed Count 82
PubMed Score 1616.90
PubTator Score 597.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 1.4e-03
hepatocellular carcinoma 1.100 1.0e-05
malignant mesothelioma -1.800 2.0e-07
psoriasis -1.500 2.8e-02
glioblastoma multiforme 1.100 8.2e-16
osteosarcoma -3.113 5.2e-07
posterior fossa group A ependymoma 1.400 2.6e-09
progressive supranuclear palsy -1.400 1.4e-02
invasive ductal carcinoma -1.400 6.5e-03
ovarian cancer -2.600 1.4e-08

Protein-protein Interaction (5)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
588590 confirmatory 4029 / 28458 / 358790 qHTS for Inhibitors of Polymerase Iota
588623 summary 0 / 0 / 0 qHTS for Inhibitors of Polymerase Iota: Summary
720496 confirmatory 1154 / 349 / 0 qHTS for Inhibitors of Polymerase Iota: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (53)

PMID Text
26370087 Mass spectrometry analysis of monoubiquitinated poliota revealed that it is ubiquitinated at over 27 unique sites. Many of these sites are localized in different functional domains of the protein.
25162224 Germline genetic variations in human POLI gene may either hinder or promote the translesion synthesis (TLS) capability of pol iota with various DNA lesions in vitro, emphasizing the potential translational importance of these pol iota genetic variations, e.g., individual differences in TLS, mutation, and cancer susceptibility to genotoxic carcinogens.
24532793 a single residue in pol iota is able to discriminate between NTPs and dNTPs during DNA synthesis.
23965998 Human Pol iota and yeast Pol zeta complex could function efficiently in the insertion and extension steps, respectively, of ranslesion synthesis and human Pol kappa and Pol eta could also extend past these lesions, albeit much less efficiently.
23922701 Dysregulation of pol iota by JNK/c-Jun is involved in carcinogenesis and offer a novel understanding of the role of pol iota or c-Jun in mutagenesis.
23727064 POLI and MC4R nearby single nucleotide polymorphisms in human chromosome 18 are associated with a moderate risk of type 2 diabetes.
23248005 Results show that the physical and functional interaction between pols eta and iota occurs between ubiquitinated forms of either polymerase via their respective ubiquitin-binding domains.
22817454 this review briefly discusses the main structural features and possible functional mechanisms of the active center of Pol iota. [review]
21454642 in mammalian cells, both polymerases kappa and iota are necessary for the error-free bypass of N(2)-CEdG and N(2)-CMdG.
21300901 structural mechanism of high-fidelity 8-oxo-G replication by a human DNA polymerase
20961860 Structural basis for proficient incorporation of dTTP opposite O6-methylguanine by human DNA polymerase iota.
20673215 In the presence of Mn2+, the Pol iota activity in carcinoma was 2.5-fold higher than the control cells.
20574454 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
20159559 The solution structures of the C-terminal UBM of human pol iota and its complex with ubiquitin are reported.
19861517 Variants in POLI is associated with predisposition for TMPRSS2-ERG fusion in prostate cancer.
19861517 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19767609 DNA polymerase iota's versatility implies that this enzyme can adjust to local structural conditions in order to bypass bulky lesions by strategies that utilize Watson-Crick, Hoogsteen and perhaps other base pairing possibilities.
19604477 Replication across template T/U by human DNA POLI is reported.
19440206 Structural and domain-swapping experiments indicate that the finger domain is responsible for DNA polymerase iota's high error rates on pyrimidines and determines the incorporation specificity.
19368886 DNA synthesis across an absaic lesion by human POLI is reported.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19162565 enzyme plays important functions in protecting humans from the deleterious consequences of exposure to both oxidative- and ultraviolet light-induced DNA damage
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18984581 Lesion bypass of N2-ethylguanine by human DNA polymerase iota.
18923427 These data reveal a novel role of human DNA pol iota in protecting cells from oxidative damage.
18799611 Data suggest that DNA polymerases eta and iota transiently probe DNA/chromatin; when DNA is exposed at replication forks, the polymerase residence times increase, and this is further facilitated by the ubiquitination of PCNA.
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18194848 Observational study of gene-disease association. (HuGE Navigator)
17609217 the cation utilized by pol iota in vivo may actually be Mn(2+) rather than Mg(2+), as tacitly assumed
17056006 These results suggest that HIF-1-mediated pol iota gene expression may be involved in the generation of translesion mutations during DNA replication after hypoxia followed by reoxygenation.
16914729 For proficient T incorporation opposite template A, only the N7 hydrogen bonding is required, but for proficient C incorporation opposite template G, hydrogen bonding at both the N7 and O(6) is an imperative.
16763556 DNA polymerases iota and eta interact noncovalently with free polyUb chains, as well as mono-ubiquitinated proliferating cell nuclear antigen (Ub-PCNA).
16527824 polymerization by pol iota is severely inhibited by a bulky group at G N2 despite an advantageous mode of Hoogsteen base pairing
16472831 results show that Pol iota has no significant role in UV lesion bypass and mutagenesis in vivo and provides some initial data suggesting that this polymerase may be involved in replication of extrachromosomal DNA
16357261 identification of two previously unknown ubiquitin-binding domains in the Y-family translesion synthesis polymerases that enable them to interact with monoubiquitinated targets and undergo monoubiquitination in vivo
16354708 The sequential action of Poliota and Polkappa promotes efficient and error-free synthesis through the HNE-dG adducts.
16195237 Observational study of gene-disease association. (HuGE Navigator)
16166652 DNA polymerase iota promotes replication through a ring-closed minor-groove adduct that adopts a syn conformation in DNA
15657443 Poliota interacts with PCNA via only one of its conserved PCNA binding motifs, regardless of whether PCNA is bound to DNA or not.
15609317 Observational study of gene-disease association. (HuGE Navigator)
15342632 Data show that an interaction between human DNA polymerase iota (poliota) and the proliferating cell nuclear antigen (PCNA) stimulates the processivity of poliota in a template-dependent manner in vitro.
15313897 Data strongly suggest that pol iota may be involved in the generation of both increased spontaneous and translesion mutations during DNA replication in breast cancer cells, thereby contributing to the accumulation of genetic damage.
15254543 crystal structure bound to a template primer and an incoming nucleotide; structure reveals a polymerase that is 'specialized' for Hoogsteen base-pairing, whereby the templating base is driven to the syn conformation
14701763 propose that the incipient base pair is accommodated differently in the active site of Poliota dependent upon the template base and that when T is the templating base, Poliota accommodates the wobble base pair better than the Watson-Crick base pair
12777390 pol iota can complement the in vitro single-nucleotide BER deficiency of a DNA polymerase beta null cell extract
12466554 Translesion replication of benzo[a]pyrene and benzo[c]phenanthrene diol epoxide adducts of deoxyadenosine and deoxyguanosine by DNA polymerase iota.
12426396 DNA polymerase iota associates with the replication machinery & accumulates at stalled replication forks following DNA-damaging treatment. Its the C-terminal 224 AAs are sufficient for both the interaction with poleta & accumulation in replication foci.
12410315 By performing gene inactivation in a Burkitt's lymphoma cell line inducible for hypermutation, we show here that somatic hypermutation is dependent on DNA polymerase iota

AA Sequence

MEKLGVEPEEEGGGDDDEEDAEAWAMELADVGAAASSQGVHDQVLPTPNASSRVIVHVDLDCFYAQVEMI      1 - 70
SNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEE     71 - 140
FSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMRE    141 - 210
AMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGI    211 - 280
NSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELL    281 - 350
ASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMV    351 - 420
NVKMPFHLTLLSVCFCNLKALNTAKKGLIDYYLMPSLSTTSRSGKHSFKMKDTHMEDFPKDKETNRDFLP    421 - 490
SGRIESTRTRESPLDTTNFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQEEILSGKSREKFQGKGSVSC    491 - 560
PLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPCEPGTSGFNSSSSSYMSSQKDYSYYLDNRLK    561 - 630
DERISQGPKEPQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDE    631 - 700
KITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK                                  701 - 740
//

Text Mined References (83)

PMID Year Title
26370087 2015 Posttranslational Regulation of Human DNA Polymerase ?.
25416956 2014 A proteome-scale map of the human interactome network.
25162224 2014 Biochemical analysis of six genetic variants of error-prone human DNA polymerase ? involved in translesion DNA synthesis.
24532793 2014 The steric gate of DNA polymerase ? regulates ribonucleotide incorporation and deoxyribonucleotide fidelity.
23965998 2013 Translesion synthesis of 8,5'-cyclopurine-2'-deoxynucleosides by DNA polymerases ?, ?, and ?.
23922701 2013 Overexpressed DNA polymerase iota regulated by JNK/c-Jun contributes to hypermutagenesis in bladder cancer.
23727064 2013 Association of POL1, MALT1, MC4R, PHLPP and DSEL single nucleotide polymorphisms in chromosome 18q region with type 2 diabetes in Tunisians.
23248005 2013 Ubiquitin mediates the physical and functional interaction between human DNA polymerases ? and ?.
22817454 2012 Structure of human DNA polymerase iota and the mechanism of DNA synthesis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21454642 2011 The roles of DNA polymerases ? and ? in the error-free bypass of N2-carboxyalkyl-2'-deoxyguanosine lesions in mammalian cells.
21300901 2011 Unique active site promotes error-free replication opposite an 8-oxo-guanine lesion by human DNA polymerase iota.
20961860 2010 Structural basis for proficient incorporation of dTTP opposite O6-methylguanine by human DNA polymerase iota.
20673215 2010 Effect of human cell malignancy on activity of DNA polymerase iota.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20226869 2010 Association between genetic variants in the base excision repair pathway and outcomes after hematopoietic cell transplantations.
20159559 2010 Unconventional ubiquitin recognition by the ubiquitin-binding motif within the Y family DNA polymerases iota and Rev1.
19861517 2009 Predisposition for TMPRSS2-ERG fusion in prostate cancer by variants in DNA repair genes.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19767609 2009 Influence of local sequence context on damaged base conformation in human DNA polymerase iota: molecular dynamics studies of nucleotide incorporation opposite a benzo[a]pyrene-derived adenine lesion.
19604477 2009 Replication across template T/U by human DNA polymerase-iota.
19440206 2009 Structural basis of error-prone replication and stalling at a thymine base by human DNA polymerase iota.
19368886 2009 DNA synthesis across an abasic lesion by human DNA polymerase iota.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19162565 2009 Insights into the cellular role of enigmatic DNA polymerase iota.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19060904 2009 An empirical framework for binary interactome mapping.
18984581 2009 Lesion bypass of N2-ethylguanine by human DNA polymerase iota.
18923427 2008 Human DNA polymerase iota protects cells against oxidative stress.
18799611 2008 Effect of proliferating cell nuclear antigen ubiquitination and chromatin structure on the dynamic properties of the Y-family DNA polymerases.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18194848 2008 No association of the POLI Thr706Ala polymorphism with the risk of cervical carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17609217 2007 Increased catalytic activity and altered fidelity of human DNA polymerase iota in the presence of manganese.
17056006 2006 Hypoxia-inducible factor-1 mediates the expression of DNA polymerase iota in human tumor cells.
16914729 2006 Role of hoogsteen edge hydrogen bonding at template purines in nucleotide incorporation by human DNA polymerase iota.
16763556 2006 Controlling the subcellular localization of DNA polymerases iota and eta via interactions with ubiquitin.
16527824 2006 Kinetic evidence for inefficient and error-prone bypass across bulky N2-guanine DNA adducts by human DNA polymerase iota.
16472831 2006 The role of DNA polymerase iota in UV mutational spectra.
16381901 2006 The LIFEdb database in 2006.
16357261 2005 Ubiquitin-binding domains in Y-family polymerases regulate translesion synthesis.
16354708 2006 Replication past a trans-4-hydroxynonenal minor-groove adduct by the sequential action of human DNA polymerases iota and kappa.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16195237 2006 Polymorphisms of DNA repair genes and risk of non-small cell lung cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16166652 2005 Human DNA polymerase iota promotes replication through a ring-closed minor-groove adduct that adopts a syn conformation in DNA.
15657443 2005 A single domain in human DNA polymerase iota mediates interaction with PCNA: implications for translesion DNA synthesis.
15609317 2005 Association of amino acid substitution polymorphisms in DNA repair genes TP53, POLI, REV1 and LIG4 with lung cancer risk.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342632 2004 Proliferating cell nuclear antigen-dependent coordination of the biological functions of human DNA polymerase iota.
15313897 2004 Altered DNA polymerase iota expression in breast cancer cells leads to a reduction in DNA replication fidelity and a higher rate of mutagenesis.
15254543 2004 Replication by human DNA polymerase-iota occurs by Hoogsteen base-pairing.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15199127 2004 Efficient and error-free replication past a minor-groove DNA adduct by the sequential action of human DNA polymerases iota and kappa.
15189446 2004 Interaction of hREV1 with three human Y-family DNA polymerases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701763 2004 Human DNA polymerase iota utilizes different nucleotide incorporation mechanisms dependent upon the template base.
14630940 2003 A mechanism for the exclusion of low-fidelity human Y-family DNA polymerases from base excision repair.
12777390 2003 Localization of the deoxyribose phosphate lyase active site in human DNA polymerase iota by controlled proteolysis.
12606586 2003 Localization of DNA polymerases eta and iota to the replication machinery is tightly co-ordinated in human cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466554 2002 Translesion replication of benzo[a]pyrene and benzo[c]phenanthrene diol epoxide adducts of deoxyadenosine and deoxyguanosine by human DNA polymerase iota.
12426396 2002 Localization of DNA polymerases eta and iota to the replication machinery is tightly co-ordinated in human cells.
12410315 2002 Induction of somatic hypermutation in immunoglobulin genes is dependent on DNA polymerase iota.
11707422 2001 Unique misinsertion specificity of poliota may decrease the mutagenic potential of deaminated cytosines.
11515498 2001 The Y-family of DNA polymerases.
11402031 2001 Human DNA polymerase iota promiscuous mismatch extension.
11387224 2001 Altered nucleotide misinsertion fidelity associated with poliota-dependent replication at the end of a DNA template.
11356150 2001 Biochemical characterization of human DNA polymerase iota provides clues to its biological function.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11251121 2001 5'-Deoxyribose phosphate lyase activity of human DNA polymerase iota in vitro.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11205331 2001 DNA polymerase iota and related rad30-like enzymes.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11013228 2000 Misinsertion and bypass of thymine-thymine dimers by human DNA polymerase iota.
10887158 2000 poliota, a remarkably error-prone human DNA polymerase.
10856253 2000 Mechanisms of accurate translesion synthesis by human DNA polymerase eta.
10458907 1999 Novel human and mouse homologs of Saccharomyces cerevisiae DNA polymerase eta.