Property Summary

NCBI Gene PubMed Count 89
PubMed Score 1701.88
PubTator Score 597.23

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
ependymoma 1.200 5.1e-08
gastric cancer 1.200 1.4e-03
glioblastoma multiforme 1.100 8.2e-16
hepatocellular carcinoma 1.100 1.0e-05
invasive ductal carcinoma -1.400 6.5e-03
malignant mesothelioma -1.800 2.0e-07
osteosarcoma -1.918 1.2e-03
ovarian cancer -2.300 1.2e-13
progressive supranuclear palsy -1.400 1.4e-02
psoriasis -1.300 3.8e-06

PDB (46)

Gene RIF (57)

AA Sequence

KITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK                                  701 - 740

Text Mined References (90)

PMID Year Title