Property Summary

NCBI Gene PubMed Count 82
Grant Count 197
R01 Count 142
Funding $28,050,657.78
PubMed Score 1616.90
PubTator Score 597.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 0.001
hepatocellular carcinoma 1.100 0.000
malignant mesothelioma -1.800 0.000
psoriasis -1.500 0.028
glioblastoma multiforme 1.100 0.000
osteosarcoma -3.113 0.000
posterior fossa group A ependymoma 1.400 0.000
progressive supranuclear palsy -1.400 0.014
invasive ductal carcinoma -1.400 0.007
ovarian cancer -2.600 0.000

Synonym

Accession Q9UNA4 Q8N590 Q9H0S1 Q9NYH6
Symbols RAD30B
RAD3OB

Gene

PDB

2KHW   2MBB   1T3N   1ZET   2ALZ   2DPI   2DPJ   2FLL   2FLN   2FLP   2KHU   2KTF   2L0F   2L0G   3EPG   3EPI   3G6V   3G6X   3G6Y   3GV5   3GV7   3GV8   3H40   3H4B   3H4D   3NGD   3OSN   3Q8P   3Q8Q   3Q8R   3Q8S   4EBC   4EBD   4EBE   4EYH   4EYI   4FS1   4FS2   5KT2   5KT3   5KT4   5KT5   5KT6   5KT7  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
588590 confirmatory 4029 / 28458 / 358790 qHTS for Inhibitors of Polymerase Iota
588623 summary 0 / 0 / 0 qHTS for Inhibitors of Polymerase Iota: Summary
720496 confirmatory 1154 / 349 / 0 qHTS for Inhibitors of Polymerase Iota: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (53)

PMID Text
26370087 Mass spectrometry analysis of monoubiquitinated poliota revealed that it is ubiquitinated at over 27 unique sites. Many of these sites are localized in different functional domains of the protein.
25162224 Germline genetic variations in human POLI gene may either hinder or promote the translesion synthesis (TLS) capability of pol iota with various DNA lesions in vitro, emphasizing the potential translational importance of these pol iota genetic variations, e.g., individual differences in TLS, mutation, and cancer susceptibility to genotoxic carcinogens.
24532793 a single residue in pol iota is able to discriminate between NTPs and dNTPs during DNA synthesis.
23965998 Human Pol iota and yeast Pol zeta complex could function efficiently in the insertion and extension steps, respectively, of ranslesion synthesis and human Pol kappa and Pol eta could also extend past these lesions, albeit much less efficiently.
23922701 Dysregulation of pol iota by JNK/c-Jun is involved in carcinogenesis and offer a novel understanding of the role of pol iota or c-Jun in mutagenesis.
23727064 POLI and MC4R nearby single nucleotide polymorphisms in human chromosome 18 are associated with a moderate risk of type 2 diabetes.
23248005 Results show that the physical and functional interaction between pols eta and iota occurs between ubiquitinated forms of either polymerase via their respective ubiquitin-binding domains.
22817454 this review briefly discusses the main structural features and possible functional mechanisms of the active center of Pol iota. [review]
21454642 in mammalian cells, both polymerases kappa and iota are necessary for the error-free bypass of N(2)-CEdG and N(2)-CMdG.
21300901 structural mechanism of high-fidelity 8-oxo-G replication by a human DNA polymerase
More...

AA Sequence

MEKLGVEPEEEGGGDDDEEDAEAWAMELADVGAAASSQGVHDQVLPTPNASSRVIVHVDLDCFYAQVEMI      1 - 70
SNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEE     71 - 140
FSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMRE    141 - 210
AMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGI    211 - 280
NSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELL    281 - 350
ASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMV    351 - 420
NVKMPFHLTLLSVCFCNLKALNTAKKGLIDYYLMPSLSTTSRSGKHSFKMKDTHMEDFPKDKETNRDFLP    421 - 490
SGRIESTRTRESPLDTTNFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQEEILSGKSREKFQGKGSVSC    491 - 560
PLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPCEPGTSGFNSSSSSYMSSQKDYSYYLDNRLK    561 - 630
DERISQGPKEPQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDE    631 - 700
KITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK                                  701 - 740
//

Text Mined References (83)

PMID Year Title
26370087 2015 Posttranslational Regulation of Human DNA Polymerase ?.
25416956 2014 A proteome-scale map of the human interactome network.
25162224 2014 Biochemical analysis of six genetic variants of error-prone human DNA polymerase ? involved in translesion DNA synthesis.
24532793 2014 The steric gate of DNA polymerase ? regulates ribonucleotide incorporation and deoxyribonucleotide fidelity.
23965998 2013 Translesion synthesis of 8,5'-cyclopurine-2'-deoxynucleosides by DNA polymerases ?, ?, and ?.
23922701 2013 Overexpressed DNA polymerase iota regulated by JNK/c-Jun contributes to hypermutagenesis in bladder cancer.
23727064 2013 Association of POL1, MALT1, MC4R, PHLPP and DSEL single nucleotide polymorphisms in chromosome 18q region with type 2 diabetes in Tunisians.
23248005 2013 Ubiquitin mediates the physical and functional interaction between human DNA polymerases ? and ?.
22817454 2012 Structure of human DNA polymerase iota and the mechanism of DNA synthesis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...