Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.51
PubTator Score 8.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.7e-10
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Gastric adenocarcinoma 3 3.91 2.0
Colon adenoma 6 3.182 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.7e-10

Gene RIF (4)

AA Sequence

MRKELQLSLSVTLLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERMEPPHLVSCS      1 - 70
VESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINAS     71 - 140
AERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMEN    141 - 210
FVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPS    211 - 280
FNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK              281 - 340
//

Text Mined References (11)

PMID Year Title