Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.28
PubTator Score 8.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Synonym

Accession Q9UNA3 Q0VDK1 Q0VDK2 Alpha4GnT
Symbols alpha4GnT

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
22307328 human alpha1,4-N-acetylglucosaminyltransferase (alpha4GnT) is responsible for O-glycan biosynthesis and has a role in preventing gastric cancer by inhibiting H. pylori infection and also suppressing tumor-promoting inflammation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19751437 Observational study of gene-disease association. (HuGE Navigator)
16441422 Up-regulation of alpha-1,4-N-acetylglucosaminyltransferase is associated with pancreatic cancer

AA Sequence

MRKELQLSLSVTLLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERMEPPHLVSCS      1 - 70
VESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINAS     71 - 140
AERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMEN    141 - 210
FVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPS    211 - 280
FNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK              281 - 340
//

Text Mined References (11)

PMID Year Title
22307328 2012 Essential role of gastric gland mucin in preventing gastric cancer in mice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19751437 2009 Genetic variation in a4GnT in relation to Helicobacter pylori serology and gastric cancer risk.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16441422 2006 Clinical utility of quantitative RT-PCR targeted to alpha1,4-N-acetylglucosaminyltransferase mRNA for detection of pancreatic cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12594234 2003 Usefulness of the real-time reverse transcription-polymerase chain reaction assay targeted to alpha1,4-N-acetylglucosaminyltransferase for the detection of gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11304796 2001 Immunohistochemical demonstration of alpha1,4-N-acetylglucosaminyltransferase that forms GlcNAcalpha1,4Galbeta residues in human gastrointestinal mucosa.
10430883 1999 Expression cloning of a human alpha1, 4-N-acetylglucosaminyltransferase that forms GlcNAcalpha1-->4Galbeta-->R, a glycan specifically expressed in the gastric gland mucous cell-type mucin.
More...