Property Summary

NCBI Gene PubMed Count 29
PubMed Score 51.87
PubTator Score 333.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Leukemia, Myelomonocytic, Juvenile 20 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gout 106 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count
Juvenile Myelomonocytic Leukemia 21

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.075 1.2e-02
active ulcerative colitis 1.281 1.1e-02
acute quadriplegic myopathy 1.540 3.8e-05
adult high grade glioma -1.500 7.7e-04
astrocytic glioma -1.600 1.5e-02
Astrocytoma, Pilocytic -1.300 1.8e-05
atypical teratoid / rhabdoid tumor -1.600 1.5e-07
Breast cancer -1.600 3.8e-08
ependymoma -1.100 3.5e-02
glioblastoma -1.300 1.0e-07
group 3 medulloblastoma -1.400 2.6e-03
intraductal papillary-mucinous adenoma (... 2.800 2.7e-04
intraductal papillary-mucinous carcinoma... 3.400 5.8e-05
intraductal papillary-mucinous neoplasm ... 2.400 3.0e-03
invasive ductal carcinoma -1.200 3.1e-03
lung cancer -1.400 3.6e-02
medulloblastoma, large-cell -2.100 8.1e-07
oligodendroglioma -1.400 3.0e-08
osteosarcoma -1.628 2.9e-03
pancreatic cancer 1.200 3.7e-06
pancreatic ductal adenocarcinoma liver m... 1.048 9.7e-03
Pick disease -1.300 6.7e-03
primitive neuroectodermal tumor -1.300 2.6e-05
psoriasis -1.800 2.3e-04
Rheumatoid arthritis 1.200 1.7e-03
subependymal giant cell astrocytoma -2.833 9.3e-03
urothelial carcinoma -1.400 1.3e-02

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (13)

AA Sequence

MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKFADSLNEFKFQ      1 - 70
CIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFRKEQIGAAKEAKKKYDKETEK     71 - 140
YCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTF    141 - 210
YHHGYELAKDFGDFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHF    211 - 280
GTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQ    281 - 350
ALSEEDRRLWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRV    351 - 420
QKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIH    421 - 490
SLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEIL    491 - 560
IENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSN    561 - 630
PNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVR    631 - 700
SVAGFVWFSVAAVVLSLARSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAE    701 - 770
HDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL                              771 - 814
//

Text Mined References (31)

PMID Year Title