Property Summary

NCBI Gene PubMed Count 28
PubMed Score 47.93
PubTator Score 333.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ependymoma 2514 2.80676856862542E-11
atypical teratoid / rhabdoid tumor 4369 4.39495030299945E-10
medulloblastoma, large-cell 6234 9.87770622271094E-9
oligodendroglioma 2849 3.0212084737244E-8
Breast cancer 3099 3.82271469455011E-8
medulloblastoma 1524 1.1517678711434E-6
primitive neuroectodermal tumor 3031 2.56865210321848E-6
pancreatic cancer 2300 3.65931271007012E-6
pilocytic astrocytoma 3086 3.06809897016271E-5
acute quadriplegic myopathy 1157 3.7763877252889E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.78509278023124E-5
psoriasis 6685 2.33860143763986E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.69617470163098E-4
glioblastoma 5572 3.03207984465375E-4
adult high grade glioma 2148 0.00105448918313554
Rheumatoid Arthritis 1171 0.00165601887061592
osteosarcoma 7933 0.00289036371139257
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00295685569443248
invasive ductal carcinoma 2950 0.0031414991634985
Pick disease 1893 0.00665657885250756
subependymal giant cell astrocytoma 2287 0.00929743434014164
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00966786539425908
active ulcerative colitis 477 0.0107926663345511
active Crohn's disease 918 0.0117463837346224
urothelial carcinoma 318 0.0132883585282831
astrocytic glioma 2241 0.0148072423150504
lung cancer 4473 0.0358691609544132
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Cerebellar Ataxia 72 3.923 2.0
Disease Target Count
Juvenile Myelomonocytic Leukemia 21
Disease Target Count
Leukemia, juvenile myelomonocytic 7

Expression

Synonym

Accession Q9UNA1 O75117 Q5D035 Q9BYS6 Q9BYS7 Q9UJ00
Symbols GRAF
GRAF1
OPHN1L
OPHN1L1

Gene

PANTHER Protein Class (2)

PDB

1UGV  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

 MGI Term (1)

 GWAS Trait (1)

Gene RIF (13)

PMID Text
26446261 We conclude that a transient interaction between Cdc42 and GRAF1 drives endocytic turnover and controls the transition essential for endosomal maturation of plasma membrane internalised by this mechanism.
25088035 GRAF expression is a favorable prognostic marker in patients with acute myeloid leukemia.
24067935 ADAR1 regulates the expression of ARHGAP26 through A-to-I RNA editing by disrupting the binding of miR-30b-3p and miR-573 within the 3' UTR of ARHGAP26.
21965292 proposed that GRAF1 remodels membrane microdomains at adhesion sites into endocytic carriers, facilitating membrane turnover during cell morphological changes
21622574 a GTPase-activating protein that regulates muscle maturation and to highlight the functional importance of BAR domains in myotube formation
21074269 Findings suggest that the hypermethylation of GRAF promoter might be one of early events in the development of AML.
20704716 Decreased level of GRAF transcript is associated with acute myeloid leukemia, myelodysplastic syndrome and chronic myeloid leukemia.
20602808 The analysis of the expression pattern of the GRAF1/OPHN-1-L gene in human tissues and organs revealed the predominant brain expression of a novel splicing isoform.
20533268 The GRAF gene was down-regulated in AML, which might play a role in the leukemogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKFADSLNEFKFQ      1 - 70
CIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFRKEQIGAAKEAKKKYDKETEK     71 - 140
YCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTF    141 - 210
YHHGYELAKDFGDFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHF    211 - 280
GTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQ    281 - 350
ALSEEDRRLWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRV    351 - 420
QKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIH    421 - 490
SLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEIL    491 - 560
IENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSN    561 - 630
PNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVR    631 - 700
SVAGFVWFSVAAVVLSLARSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAE    701 - 770
HDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL                              771 - 814
//

Text Mined References (30)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26446261 2015 Endocytic membrane turnover at the leading edge is driven by a transient interaction between Cdc42 and GRAF1.
25416956 2014 A proteome-scale map of the human interactome network.
25088035 2014 High expression of GTPase regulator associated with the focal adhesion kinase (GRAF) is a favorable prognostic factor in acute myeloid leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24067935 2013 ADAR1 regulates ARHGAP26 gene expression through RNA editing by disrupting miR-30b-3p and miR-573 binding.
21965292 2011 The endocytic protein GRAF1 is directed to cell-matrix adhesion sites and regulates cell spreading.
21622574 2011 Skeletal muscle differentiation and fusion are regulated by the BAR-containing Rho-GTPase-activating protein (Rho-GAP), GRAF1.
21074269 2011 Abnormal methylation of GRAF promoter Chinese patients with acute myeloid leukemia.
20704716 2010 GTPase regulator associated with the focal adhesion kinase (GRAF) transcript was down-regulated in patients with myeloid malignancies.
More...