Property Summary

Ligand Count 203
NCBI Gene PubMed Count 86
PubMed Score 168.44
PubTator Score 122.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.700 3.9e-03
Breast cancer -1.600 3.1e-02
breast carcinoma -2.500 1.3e-06
cystic fibrosis -1.687 3.5e-05
ductal carcinoma in situ -2.700 4.1e-04
group 4 medulloblastoma -1.300 2.6e-02
intraductal papillary-mucinous adenoma (... -1.900 5.5e-03
intraductal papillary-mucinous carcinoma... -1.900 7.8e-03
intraductal papillary-mucinous neoplasm ... -2.200 1.5e-02
invasive ductal carcinoma -1.660 4.4e-05
oligodendroglioma 1.800 4.8e-03
osteosarcoma 1.515 2.2e-02
ovarian cancer -1.800 2.4e-04
posterior fossa group B ependymoma -1.100 3.3e-03
ulcerative colitis 1.300 3.8e-03

 GWAS Trait (1)

Gene RIF (72)

AA Sequence

MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGHPHPLAQRRRS      1 - 70
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSP     71 - 140
RSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGSARILHVYTREGFSFEALPPRASCE    141 - 210
TPASTPEAHEHAPAHSNPSGRAALASQLLDQSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMA    211 - 280
RLYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQ    281 - 350
LGDDHEEHYDAAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH    351 - 420
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQT    421 - 490
YDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKK    491 - 560
YYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPRNNGRYCTGKRAIYRSCSLMPCPPNGKSFRH    561 - 630
EQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVR    631 - 700
GKCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTR    701 - 770
FTAYLALKKKNGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT    771 - 840
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLA    841 - 910
KGCPLSQRPSAFKQCLLKKC                                                      911 - 930
//

Text Mined References (88)

PMID Year Title