Property Summary

NCBI Gene PubMed Count 75
PubMed Score 149.84
PubTator Score 122.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
breast carcinoma 1614 1.00313793981518E-48
Breast cancer 3099 3.1355293061051E-37
cystic fibrosis 1670 1.02818118478127E-7
invasive ductal carcinoma 2950 1.04995397592415E-4
ductal carcinoma in situ 1745 4.01718110844695E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.05465434862267E-4
ovarian cancer 8492 9.40310341165116E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00331711127726234
osteosarcoma 7933 0.00333270734241035
posterior fossa group B ependymoma 1530 0.00334230646992374
ulcerative colitis 2087 0.00376723124990384
astrocytic glioma 2241 0.00392526616204814
oligodendroglioma 2849 0.00482107148949877
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00564863798214168
group 4 medulloblastoma 1875 0.0122194649180413
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteoarthritis 96 6.656 3.3
Degenerative disc disease 28 5.316 2.7
Synovitis 72 3.215 1.6

Expression

Synonym

Accession Q9UNA0 Q52LV4 Q9UKP2 ADAM-TS 5
Symbols ADMP-2
ADAM-TS5
ADAMTS-5
ADAMTS11
ADAM-TS 5
ADAMTS-11
ADAM-TS 11

Gene

PDB

2RJQ   3B8Z   3HY7   3HY9   3HYG   3LJT  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (59)

PMID Text
26707794 The findings of our study suggest that hsamiR15a exerts protective effects against osteoarthritis by targeting ADAMTS5 in human chondrocytes.
26668318 Data suggest that ADAMTS-5 oligomerization is required for full aggrecanase activity in vitro and in situ (as seen in knee joint of mouse model of inflammatory arthritis); thus, blocking oligomerization inhibits ADAMTS-5 activity.
26612259 These data demonstrate that the antibody is specific to ADAMTS4 and ADAMTS5 and inhibits their aggrecanase activity at molecular and cellular levels.
26303525 Western blot analysis of endogenous ADAMTS-5 expressed by human chondrocytes showed the presence largely of truncated forms of ADAMTS-5, thus explaining the lack of efficacy of the anti-Sp antibody.
25848214 The data showed that the expression of ADAMTS5 was reduced in HCC, which was inversely associated with VEGF expression, MVD, and tumor size and associated with poor overall survival of HCC patients.
25477257 Evaluate ADAMTS-4 and ADAMTS-5 immunohistochemical expression in human TMJ discs from patients affected by internal derangement.
25122765 The ADAMTS5 ancillary domain and specific chondroitin sulfate chains of versican are required for proteolysis.
24786121 The restricted expression of ADAMTS-4 and ADAMTS-5 and their increased expression in gestational trophoblastic diseases suggest that these 2 ADAMTS subtypes are associated with human placentation and the development of gestational trophoblastic diseases.
24732836 We conclude that the upregulation of TNF-alpha and ADAMTS-5, but not ADAMTS-4, may play an important role in degenerative cartilage endplate-induced low back pain.
24474687 This study highlights that the affinity between a ligand and LRP1 dictates the rate of internalization and suggests that LRP1 is a major traffic controller of the two aggrecanases, especially under inflammatory conditions, where the protein levels of ADAMTS-4 increase, but those of ADAMTS-5 do not.
More...

AA Sequence

MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGHPHPLAQRRRS      1 - 70
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSP     71 - 140
RSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGSARILHVYTREGFSFEALPPRASCE    141 - 210
TPASTPEAHEHAPAHSNPSGRAALASQLLDQSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMA    211 - 280
RLYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQ    281 - 350
LGDDHEEHYDAAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH    351 - 420
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQT    421 - 490
YDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKK    491 - 560
YYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPRNNGRYCTGKRAIYRSCSLMPCPPNGKSFRH    561 - 630
EQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVR    631 - 700
GKCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTR    701 - 770
FTAYLALKKKNGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT    771 - 840
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLA    841 - 910
KGCPLSQRPSAFKQCLLKKC                                                      911 - 930
//

Text Mined References (76)

PMID Year Title
26888488 2016 Role of ADAMTS1 and ADAMTS5 in male infertility.
26738863 2016 Overexpression of ADAMTS5 can regulate the migration and invasion of non-small cell lung cancer.
26707794 2016 Hsa-miR-15a exerts protective effects against osteoarthritis by targeting aggrecanase-2 (ADAMTS5) in human chondrocytes.
26668318 2016 A Disintegrin and Metalloproteinase with Thrombospondin Motifs-5 (ADAMTS-5) Forms Catalytically Active Oligomers.
26657033 2016 Anti-ADAMTS5 monoclonal antibodies: implications for aggrecanase inhibition in osteoarthritis.
26612259 2016 Development of human neutralizing antibody to ADAMTS4 (aggrecanase-1) and ADAMTS5 (aggrecanase-2).
26303525 2015 Antibody-based exosite inhibitors of ADAMTS-5 (aggrecanase-2).
25848214 2015 Lost expression of ADAMTS5 protein associates with progression and poor prognosis of hepatocellular carcinoma.
25477257 2015 ADAMTS-4 and ADAMTS-5 expression in human temporomandibular joint discs with internal derangement, correlates with degeneration.
25122765 2014 Determinants of versican-V1 proteoglycan processing by the metalloproteinase ADAMTS5.
More...