Property Summary

NCBI Gene PubMed Count 75
Grant Count 43
R01 Count 31
Funding $3,643,232.94
PubMed Score 149.84
PubTator Score 122.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (59)

PMID Text
26707794 The findings of our study suggest that hsamiR15a exerts protective effects against osteoarthritis by targeting ADAMTS5 in human chondrocytes.
26668318 Data suggest that ADAMTS-5 oligomerization is required for full aggrecanase activity in vitro and in situ (as seen in knee joint of mouse model of inflammatory arthritis); thus, blocking oligomerization inhibits ADAMTS-5 activity.
26612259 These data demonstrate that the antibody is specific to ADAMTS4 and ADAMTS5 and inhibits their aggrecanase activity at molecular and cellular levels.
26303525 Western blot analysis of endogenous ADAMTS-5 expressed by human chondrocytes showed the presence largely of truncated forms of ADAMTS-5, thus explaining the lack of efficacy of the anti-Sp antibody.
25848214 The data showed that the expression of ADAMTS5 was reduced in HCC, which was inversely associated with VEGF expression, MVD, and tumor size and associated with poor overall survival of HCC patients.
25477257 Evaluate ADAMTS-4 and ADAMTS-5 immunohistochemical expression in human TMJ discs from patients affected by internal derangement.
25122765 The ADAMTS5 ancillary domain and specific chondroitin sulfate chains of versican are required for proteolysis.
24786121 The restricted expression of ADAMTS-4 and ADAMTS-5 and their increased expression in gestational trophoblastic diseases suggest that these 2 ADAMTS subtypes are associated with human placentation and the development of gestational trophoblastic diseases.
24732836 We conclude that the upregulation of TNF-alpha and ADAMTS-5, but not ADAMTS-4, may play an important role in degenerative cartilage endplate-induced low back pain.
24474687 This study highlights that the affinity between a ligand and LRP1 dictates the rate of internalization and suggests that LRP1 is a major traffic controller of the two aggrecanases, especially under inflammatory conditions, where the protein levels of ADAMTS-4 increase, but those of ADAMTS-5 do not.
More...

AA Sequence

MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGHPHPLAQRRRS      1 - 70
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSP     71 - 140
RSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGSARILHVYTREGFSFEALPPRASCE    141 - 210
TPASTPEAHEHAPAHSNPSGRAALASQLLDQSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMA    211 - 280
RLYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQ    281 - 350
LGDDHEEHYDAAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH    351 - 420
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQT    421 - 490
YDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKK    491 - 560
YYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPRNNGRYCTGKRAIYRSCSLMPCPPNGKSFRH    561 - 630
EQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVR    631 - 700
GKCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTR    701 - 770
FTAYLALKKKNGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT    771 - 840
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLA    841 - 910
KGCPLSQRPSAFKQCLLKKC                                                      911 - 930
//

Text Mined References (76)

PMID Year Title
26888488 2016 Role of ADAMTS1 and ADAMTS5 in male infertility.
26738863 2016 Overexpression of ADAMTS5 can regulate the migration and invasion of non-small cell lung cancer.
26707794 2016 Hsa-miR-15a exerts protective effects against osteoarthritis by targeting aggrecanase-2 (ADAMTS5) in human chondrocytes.
26668318 2016 A Disintegrin and Metalloproteinase with Thrombospondin Motifs-5 (ADAMTS-5) Forms Catalytically Active Oligomers.
26657033 2016 Anti-ADAMTS5 monoclonal antibodies: implications for aggrecanase inhibition in osteoarthritis.
26612259 2016 Development of human neutralizing antibody to ADAMTS4 (aggrecanase-1) and ADAMTS5 (aggrecanase-2).
26303525 2015 Antibody-based exosite inhibitors of ADAMTS-5 (aggrecanase-2).
25848214 2015 Lost expression of ADAMTS5 protein associates with progression and poor prognosis of hepatocellular carcinoma.
25477257 2015 ADAMTS-4 and ADAMTS-5 expression in human temporomandibular joint discs with internal derangement, correlates with degeneration.
25122765 2014 Determinants of versican-V1 proteoglycan processing by the metalloproteinase ADAMTS5.
More...