Property Summary

NCBI Gene PubMed Count 23
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Micronuclei, Chromosome-Defective 19

Gene RIF (16)

PMID Text
26716650 Our results show that L1-ORF2p is overexpressed in tumor and in preneoplastic colon and prostate tissues; this latter finding suggests that ORF2p could be considered as a potential early diagnostic biomarker.
26448937 The %(m)C(u)C and %(u)C(m)C of LINE-1s may be promising markers for monitoring hydatidiform moles before progression to GTN.
26259033 LINE-1 contributes to the genetic evolution of Pancreatic ductal adenocarcinoma (PDAC) and suggest that somatic insertions are acquired discontinuously in gastrointestinal neoplasms.
26172297 As a global epigenetic change, LINE-1 hypomethylation in normal colon mucosa might be associated with a worse outcome in certain Chinese patients with colon cancer.
25782871 LINE-1 hypomethylation is associated with Helicobacter pylori infection in gastric mucosa
25647737 Suggest that LINE-1 hypermethylation in peripheral blood of melanoma patients is a potential epigenetic biomarker for metastasis occurrence.
25120789 LINE-1 methylation is not correlated with the clinical characteristics of aldosterone-producing adenoma
24971511 Alu and LINE-1 hypomethylation is associated with HER2 enriched subtype of breast cancer
24304685 LINE-1 hypomethylation is an early molecular event involved in ovarian endometrioid adenocarcinoma and ovarian clear cell carcinoma malignant transformation.
24150097 It is a repetitive DNA retrotransposon that duplicates via a copy-and-paste genetic mechanism and its methylation levels is related to prognosis of patients with gastrointestinal neoplasm.
More...

AA Sequence

MGKKQNRKTGNSKTQSASPPPKERSSSPATEQSWMENDFDELREEGFRRSNYSELREDIQTKGKEVENFE      1 - 70
KNLEECITRITNTEKCLKELMELKTKARELREECRSLRSRCDQLEERVSAMEDEMNEMKREGKFREKRIK     71 - 140
RNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSR    141 - 210
RATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTADLSAETLQARREWGPIFNILKEKNFQPRI    211 - 280
SYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQPLQNHAKM                281 - 338
//

Text Mined References (28)

PMID Year Title
26716650 2016 Enhanced expression of LINE-1-encoded ORF2 protein in early stages of colon and prostate transformation.
26448937 2015 LINE-1 Methylation Patterns as a Predictor of Postmolar Gestational Trophoblastic Neoplasia.
26259033 2015 Retrotransposon insertions in the clonal evolution of pancreatic ductal adenocarcinoma.
26172297 2015 LINE-1 hypomethylation in normal colon mucosa is associated with poor survival in Chinese patients with sporadic colon cancer.
25782871 2015 Relationship between LINE-1 hypomethylation and Helicobacter pylori infection in gastric mucosae.
25647737 2015 LINE-1 hypermethylation in peripheral blood of cutaneous melanoma patients is associated with metastasis.
25120789 2014 Decreased LINE-1 methylation levels in aldosterone-producing adenoma.
24971511 2014 Alu and LINE-1 hypomethylation is associated with HER2 enriched subtype of breast cancer.
24304685 2014 Differences in LINE-1 methylation between endometriotic ovarian cyst and endometriosis-associated ovarian cancer.
24267889 2013 Affinity proteomics reveals human host factors implicated in discrete stages of LINE-1 retrotransposition.
More...