Property Summary

NCBI Gene PubMed Count 25
PubMed Score 22.61
PubTator Score 25.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 7.16149159640167E-291
lung carcinoma 2844 1.03219900482047E-25
breast carcinoma 1614 6.15566592592046E-16
Breast cancer 3099 4.33314262344922E-15
ulcerative colitis 2087 3.47762973250966E-12
non-small cell lung cancer 2798 1.65945561480011E-9
pancreatic cancer 2300 1.23395501981413E-7
lung cancer 4473 1.96326461243516E-5
cystic fibrosis 1670 2.01472684817068E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.22148567521392E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.63312847194587E-4
nasopharyngeal carcinoma 1056 8.7155905213834E-4
active Crohn's disease 918 0.00153577701831072
pituitary cancer 1972 0.0053239794607205
lung adenocarcinoma 2714 0.00902980323675548
uncontrolled asthma 67 0.0120892070110068
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0176082158274255
esophageal adenocarcinoma 737 0.0230512937469017
Barrett's esophagus 185 0.0236484070235368
spina bifida 1064 0.0350809827896608
Disease Target Count Z-score Confidence
Obesity 616 0.0 4.0
Disease Target Count Z-score Confidence
Systemic primary carnitine deficiency disease 16 3.158 1.6

Synonym

Accession Q9UN76 Q5H942
Symbols BMIQ11

Gene

PANTHER Protein Class (2)

  Ortholog (15)

Gene RIF (14)

PMID Text
27172637 results indicate a significant correlation between T132903C and C109869T single nucleotide polymorphisms in the insulin receptor and solute carrier family 6 member 14 amino acid transporter(SLC6A14) genes with idiopathic infertility in Persian males
26160208 SLC6A14 and 5-HTR2C polymorphisms are associated with food intake and nutritional status in children.
26106611 Very little is known about the role of SLC6A14 in PDAC and our results demonstrate that this target merits further investigation as a candidate transporter for functional imaging of pancreatic ductal adenocarcinoma .
22466613 Single nucleotide polymorphism in SLC6A14 gene is associated with cystic fibrosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19876004 Observational study of gene-disease association. (HuGE Navigator)
18700007 The five gene transcripts (aldolase B, elafin, MST-1, simNIPhom and SLC6A14) were changed in patients with ulcerative colitis, and were related to the disease activity.
18599538 The SLC6A14 gene encodes the transport protein known as the beta-alanine carrier which, due to its broad substrate specificity, is likely to play an important role in absorption of essential nutrients and drugs.
15905073 The up-regulation of SLC6A14 may have a pathogenic role in colorectal neoplasms.
More...

AA Sequence

MDKLKCPSFFKCREKEKVSASSENFHVGENDENQDRGNWSKKSDYLLSMIGYAVGLGNVWRFPYLTYSNG      1 - 70
GGAFLIPYAIMLALAGLPLFFLECSLGQFASLGPVSVWRILPLFQGVGITMVLISIFVTIYYNVIIAYSL     71 - 140
YYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPG    141 - 210
QLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKVVYFTALFPYVVLLILL    211 - 280
VRGATLEGASKGISYYIGAQSNFTKLKEAEVWKDAATQIFYSLSVAWGGLVALSSYNKFKNNCFSDAIVV    281 - 350
CLTNCLTSVFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFWSILFFFMLLTLG    351 - 420
LDSQFASIETITTTIQDLFPKVMKKMRVPITLGCCLVLFLLGLVCVTQAGIYWVHLIDHFCAGWGILIAA    421 - 490
ILELVGIIWIYGGNRFIEDTEMMIGAKRWIFWLWWRACWFVITPILLIAIFIWSLVQFHRPNYGAIPYPD    491 - 560
WGVALGWCMIVFCIIWIPIMAIIKIIQAKGNIFQRLISCCRPASNWGPYLEQHRGERYKDMVDPKKEADH    561 - 630
EIPTVSGSRKPE                                                              631 - 642
//

Text Mined References (26)

PMID Year Title
27172637 Four Single Nucleotide Polymorphisms in INSR, SLC6A14, TAS2R38, and OR2W3 Genes in Association with Idiopathic Infertility in Persian Men.
26160208 2015 SLC6A14 and 5-HTR2C polymorphisms are associated with food intake and nutritional status in children.
26106611 2015 Transcriptomic and Immunohistochemical Profiling of SLC6A14 in Pancreatic Ductal Adenocarcinoma.
22466613 2012 Multiple apical plasma membrane constituents are associated with susceptibility to meconium ileus in individuals with cystic fibrosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
18700007 2008 Five mucosal transcripts of interest in ulcerative colitis identified by quantitative real-time PCR: a prospective study.
More...