Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.79
PubTator Score 25.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
cystic fibrosis 2.000 2.0e-04
active Crohn's disease 5.526 1.5e-03
active ulcerative colitis 6.158 1.5e-03
Barrett's esophagus 2.900 2.4e-02
Breast cancer -4.700 4.3e-15
breast carcinoma -1.200 1.3e-02
esophageal adenocarcinoma 2.600 2.3e-02
intraductal papillary-mucinous adenoma (... 6.100 2.2e-04
intraductal papillary-mucinous carcinoma... 4.300 1.8e-02
intraductal papillary-mucinous neoplasm ... 8.100 8.6e-04
lung adenocarcinoma -1.100 9.0e-03
lung cancer -3.500 2.0e-05
lung carcinoma -5.000 1.0e-25
nasopharyngeal carcinoma -2.700 8.7e-04
non-small cell lung cancer -2.465 1.7e-09
pancreatic cancer 4.200 1.2e-07
pituitary cancer -2.000 5.3e-03
psoriasis 3.500 3.3e-10
spina bifida -3.022 3.5e-02
uncontrolled asthma 1.100 1.2e-02

Gene RIF (15)

AA Sequence

MDKLKCPSFFKCREKEKVSASSENFHVGENDENQDRGNWSKKSDYLLSMIGYAVGLGNVWRFPYLTYSNG      1 - 70
GGAFLIPYAIMLALAGLPLFFLECSLGQFASLGPVSVWRILPLFQGVGITMVLISIFVTIYYNVIIAYSL     71 - 140
YYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPG    141 - 210
QLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKVVYFTALFPYVVLLILL    211 - 280
VRGATLEGASKGISYYIGAQSNFTKLKEAEVWKDAATQIFYSLSVAWGGLVALSSYNKFKNNCFSDAIVV    281 - 350
CLTNCLTSVFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFWSILFFFMLLTLG    351 - 420
LDSQFASIETITTTIQDLFPKVMKKMRVPITLGCCLVLFLLGLVCVTQAGIYWVHLIDHFCAGWGILIAA    421 - 490
ILELVGIIWIYGGNRFIEDTEMMIGAKRWIFWLWWRACWFVITPILLIAIFIWSLVQFHRPNYGAIPYPD    491 - 560
WGVALGWCMIVFCIIWIPIMAIIKIIQAKGNIFQRLISCCRPASNWGPYLEQHRGERYKDMVDPKKEADH    561 - 630
EIPTVSGSRKPE                                                              631 - 642
//

Text Mined References (27)

PMID Year Title