Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.40
PubTator Score 6.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.600 3.5e-03
Astrocytoma, Pilocytic 2.200 1.1e-03
atypical teratoid / rhabdoid tumor 1.800 2.8e-03
ependymoma 2.500 2.6e-02
glioblastoma 1.600 1.1e-02
medulloblastoma, large-cell 1.200 2.9e-05
oligodendroglioma 1.300 4.4e-03
osteosarcoma 1.277 1.4e-05
Pick disease -1.100 1.8e-03

Gene RIF (2)

AA Sequence

MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVS      1 - 70
GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEM     71 - 140
KLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKYAELVLERALDREREPSL    141 - 210
QLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATDLDEGPNGEII    211 - 280
YSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAP    281 - 350
EITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETV    351 - 420
PEYNLSITARDAGTPSLSALTIVRVQVSDINDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNA    421 - 490
RLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHISDGGTPVLATNISVNIFVTDR    491 - 560
NDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST    561 - 630
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLIL    631 - 700
VSVGFVVTVFGVIIFKVYKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSD    701 - 770
PLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTW    771 - 840
PNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAA    841 - 910
GKRDGKAPAGGNGNKKKSGKKEKK                                                  911 - 934
//

Text Mined References (16)

PMID Year Title