Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.40
PubTator Score 6.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.85420278830628E-5
osteosarcoma 7933 4.3693714386028E-5
oligodendroglioma 2849 5.75441121817188E-4
pilocytic astrocytoma 3086 0.00130857492072573
Pick disease 1893 0.00182810664405247
atypical teratoid / rhabdoid tumor 4369 0.00278662358375837
astrocytic glioma 2241 0.00346096805196157
glioblastoma 5572 0.0105350326622052
ependymoma 2514 0.0262407350340983

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.600 0.003
ependymoma 2.500 0.026
oligodendroglioma 3.900 0.001
osteosarcoma 2.040 0.000
atypical teratoid / rhabdoid tumor 1.800 0.003
glioblastoma 1.600 0.011
medulloblastoma, large-cell 1.200 0.000
pilocytic astrocytoma 2.200 0.001
Pick disease -1.100 0.002

Synonym

Accession Q9UN70 O60622 Q08192 Q9Y5C4 PCDH-gamma-C3
Symbols PC43
PCDH2
PCDH-GAMMA-C3

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
22249255 our data suggest that the PCDH LRES is an important tumour suppressor locus in colorectal cancer, and that PCDHGC3 may be a strong marker and driver for the adenoma-carcinoma transition.
16751190 ADAM10 is the protease responsible for constitutive and regulated Pcdh gamma shedding events that modulate the cell adhesion role of Pcdh gamma.

AA Sequence

MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVS      1 - 70
GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEM     71 - 140
KLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKYAELVLERALDREREPSL    141 - 210
QLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATDLDEGPNGEII    211 - 280
YSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAP    281 - 350
EITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETV    351 - 420
PEYNLSITARDAGTPSLSALTIVRVQVSDINDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNA    421 - 490
RLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHISDGGTPVLATNISVNIFVTDR    491 - 560
NDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST    561 - 630
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLIL    631 - 700
VSVGFVVTVFGVIIFKVYKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSD    701 - 770
PLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTW    771 - 840
PNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAA    841 - 910
GKRDGKAPAGGNGNKKKSGKKEKK                                                  911 - 934
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22249255 2012 Long-range epigenetic silencing of chromosome 5q31 protocadherins is involved in early and late stages of colorectal tumorigenesis through modulation of oncogenic pathways.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16751190 2006 Regulated ADAM10-dependent ectodomain shedding of gamma-protocadherin C3 modulates cell-cell adhesion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
More...