Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.58

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
lung carcinoma 2844 7.21286576219699E-12
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.500 0.000


Accession Q9UN66 B9EGV1 PCDH-beta-8
Symbols PCDH3I


PANTHER Protein Class (2)

  Ortholog (2)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG

Gene RIF (1)

22082156 Knockdown of protocadherin beta 8 (PCDHB8) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

VLPNIQGHSFGPEMEQNSNFRNGFGFSLQLK                                           771 - 801

Text Mined References (9)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11322959 2001 The human and murine protocadherin-beta one-exon gene families show high evolutionary conservation, despite the difference in gene number.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
10380929 1999 A striking organization of a large family of human neural cadherin-like cell adhesion genes.