Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.14
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
permanent atrial fibrillation 1.300 0.000
Duchenne muscular dystrophy 1.107 0.000

Synonym

Accession Q9UN42 Q17RR0 Q9UN41
Symbols

Gene

Gene RIF (3)

PMID Text
24420862 variant in the coding region of the ATP1B4 gene may play little or no role in the development of PD in Chinese Han population.
23333304 HIV-1 Vif upregulates the expression of ATPase, Na+/K+ transporting, beta 4 polypeptide (ATP1B4) in Vif-expression T cells
16430714 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEE      1 - 70
EEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFLTISP     71 - 140
YIPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQD    141 - 210
GNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIR    211 - 280
SISYYPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVI    281 - 350
FTLNIET                                                                   351 - 357
//

Text Mined References (9)

PMID Year Title
24420862 2014 Genetic analysis of the ATP1B4 gene in Chinese Han patients with Parkinson's disease.
21855530 2011 Isolation and characterization of BetaM protein encoded by ATP1B4--a unique member of the Na,K-ATPase ?-subunit gene family.
17592128 2007 Evolution of Na,K-ATPase beta m-subunit into a coregulator of transcription in placental mammals.
16430714 2006 Thyrotoxic periodic paralysis and polymorphisms of sodium-potassium ATPase genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14656723 2004 Accumulation of beta (m), a structural member of X,K-ATPase beta-subunit family, in nuclear envelopes of perinatal myocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10456317 1999 Identification of a novel gene of the X,K-ATPase beta-subunit family that is predominantly expressed in skeletal and heart muscles.