Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.78
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Duchenne muscular dystrophy 601 5.4e-06
permanent atrial fibrillation 45 4.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Kufor-Rakeb syndrome 4 4.644 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
Duchenne muscular dystrophy 1.107 5.4e-06
permanent atrial fibrillation 1.300 4.0e-04

Gene RIF (3)

AA Sequence

MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEE      1 - 70
EEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFLTISP     71 - 140
YIPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQD    141 - 210
GNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIR    211 - 280
SISYYPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVI    281 - 350
FTLNIET                                                                   351 - 357
//

Text Mined References (9)

PMID Year Title