Property Summary

NCBI Gene PubMed Count 66
PubMed Score 49.54
PubTator Score 102.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.4e-06
psoriasis 6694 1.4e-04
Disease Target Count Z-score Confidence
Danon disease 8 3.584 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.700 4.4e-06
psoriasis -1.200 1.4e-04

Protein-protein Interaction (4)

Gene RIF (51)

AA Sequence

MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKL      1 - 70
KDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALK     71 - 140
EAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVK    141 - 210
NLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSA    211 - 280
IRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQ    281 - 350
SATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA    351 - 420
DDLLKVKKFSEDFGQES                                                         421 - 437
//

Text Mined References (71)

PMID Year Title