Property Summary

NCBI Gene PubMed Count 62
Grant Count 26
R01 Count 6
Funding $4,188,814.32
PubMed Score 50.42
PubTator Score 102.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.200 0.000
ovarian cancer 1.700 0.000

Gene RIF (57)

PMID Text
26551458 These results point to the existence of previously undetected biological functions of the FTase alpha subunit that includes control of intracellular membrane trafficking.
25534348 Ca2+-dependent accumulation of ESCRT III-Vps4 complex following large focal injury to the cell membrane and identify the role of ALG-2 as the initiator of sequential ESCRT III-Vps4A/B complex assembly.
25503676 Vps4A may function as a tumor suppressor, which utilizes exosomes as mediators to regulate the secretion and uptake of miRNAs in hepatoma cells; these observations provide new insights into the development of HCC.
25496667 HIV-1 Nef targets CD4 to CD63-containing lysosomes for Nef-induced degradation of CD4, which requires the VPS4-mediated ESCRT machinery
25164817 Vps4 stimulatory element of the cofactor Vta1 contacts the ATPase Vps4 alpha7 and alpha9 subunits to stimulate ATP hydrolysis.
25099357 HIV-1 Nef targets CD4 to CD63-containing lysosomes for Nef-induced degradation of CD4, which requires the VPS4-mediated ESCRT machinery
25099357 HIV-1 Nef targets CD4 to CD63-containing lysosomes for Nef-induced degradation of CD4, which requires the VPS4-mediated ESCRT machinery
25099357 HIV-1 Nef targets CD4 to CD63-containing lysosomes for Nef-induced degradation of CD4, which requires the VPS4-mediated ESCRT machinery
25033200 these experiments suggest that miR-16 and VPS4a expression are altered in end-stage heart failure and in response to unloading with a left ventricular assist device
24878737 HIV-1 Nef targets CD4 to CD63-containing lysosomes for Nef-induced degradation of CD4, which requires the VPS4-mediated ESCRT machinery
More...

AA Sequence

MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKL      1 - 70
KDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALK     71 - 140
EAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVK    141 - 210
NLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSA    211 - 280
IRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQ    281 - 350
SATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA    351 - 420
DDLLKVKKFSEDFGQES                                                         421 - 437
//

Text Mined References (66)

PMID Year Title
26551458 2015 Mammalian farnesyltransferase ? subunit regulates vacuolar protein sorting-associated protein 4A (Vps4A)--dependent intracellular trafficking through recycling endosomes.
25534348 2014 Mechanism of Ca²?-triggered ESCRT assembly and regulation of cell membrane repair.
25503676 2015 Vps4A functions as a tumor suppressor by regulating the secretion and uptake of exosomal microRNAs in human hepatoma cells.
25164817 2014 Vps4 stimulatory element of the cofactor Vta1 contacts the ATPase Vps4 ?7 and ?9 to stimulate ATP hydrolysis.
25033200 2014 Identification of a new target of miR-16, Vacuolar Protein Sorting 4a.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24814515 2014 ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4.
24107264 2013 ESCRT requirements for EIAV budding.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
More...