Property Summary

NCBI Gene PubMed Count 112
Grant Count 4
R01 Count 4
Funding $383,750
PubMed Score 127.50
PubTator Score 127.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
pancreatic cancer -1.100 0.005
Barrett's esophagus -1.200 0.031
esophageal adenocarcinoma -2.200 0.018
psoriasis -2.900 0.000
cutaneous lupus erythematosus -1.400 0.039
glioblastoma -3.200 0.003
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -4.200 0.000
primitive neuroectodermal tumor -2.600 0.000
juvenile dermatomyositis -1.276 0.000
adrenocortical carcinoma -1.471 0.011
non-small cell lung cancer -1.125 0.000
lung cancer -2.900 0.000
colon cancer -1.800 0.002
breast carcinoma -2.100 0.000
interstitial cystitis -1.700 0.000
lung adenocarcinoma -2.100 0.000
adult high grade glioma -3.000 0.000
pancreatic carcinoma -1.100 0.005
subependymal giant cell astrocytoma -4.816 0.006
invasive ductal carcinoma -2.220 0.001
nasopharyngeal carcinoma -1.300 0.000
Breast cancer -3.400 0.000
ductal carcinoma in situ -2.200 0.004
ulcerative colitis -1.600 0.000
Down syndrome 2.500 0.003
dermatomyositis -3.000 0.002

Gene RIF (89)

PMID Text
26976975 Study shows that NDRG2 was significantly down-regulated in glioblastomas (GBM) and seems to play a role in GBM prognosis. The low expression of NDRG2 at the mRNA level leads to a longer progression-free survival independent of methylation status.
26813459 miR-301a/b-NDRG2 might be an important axis modulating autophagy and viability of prostate cancer cells under hypoxia.
26802650 NDRG2 overexpression enhanced sodium/iodide symporter level in thyroid tumor cells and increased their iodine uptake in vitro.
26506239 Stuidies indicate the potential of N-myc downstream-regulated gene 2 (NDRG2) as a therapeutic target for cancer.
26341979 This review summarizes the distribution and subcellular localization of NDRG2 in brain tissues, highlights the physiological actions of NDRG2 in the nervous system, and discusses the roles of NDRG2 during the occurrence of nervous system disease. [review]
26317652 NDRG2 functions as an essential regulator in glycolysis and glutaminolysis via repression of c-Myc, and acts as a suppressor of carcinogenesis.
26292259 Loss of NDRG2 induced the expression of matrix metalloproteinase-19 (MMP-19), which regulated the expression of Slug at the transcriptional level in the epithelial-mesenchymal transition of gallbladder carcinoma cells.
26269411 The forced expression of NDRG2 in ATL cells down-regulates not only the canonical pathway by inhibiting AKT signaling but also the non-canonical pathway by inducing NF-kappaB-inducing kinase (NIK) dephosphorylation via the recruitment of PP2A
26250123 Epigenetic silencing of NDRG2 promotes colorectal cancer proliferation and invasion.
26239274 NDRG2 suppresses the proliferation of human bladder cancer cells via induction of oncosis.
More...

AA Sequence

MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHD      1 - 70
VGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTI     71 - 140
IGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGN    141 - 210
SELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDP    211 - 280
TQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLS    281 - 350
QSSESGTLSSGPPGHTMEVSC                                                     351 - 371
//

Text Mined References (121)

PMID Year Title
26976975 2016 NDRG2 and NDRG4 Expression Is Altered in Glioblastoma and Influences Survival in Patients with MGMT-methylated Tumors.
26813459 2016 Hypoxia induced upregulation of miR-301a/b contributes to increased cell autophagy and viability of prostate cancer cells by targeting NDRG2.
26802650 2016 Overexpression of NDRG2 Increases Iodine Uptake and Inhibits Thyroid Carcinoma Cell Growth In Situ and In Vivo.
26506239 2016 Emerging role of N-myc downstream-regulated gene 2 (NDRG2) in cancer.
26341979 2015 N-myc downstream-regulated gene 2 in the nervous system: from expression pattern to function.
26317652 2015 Tumor suppressor NDRG2 inhibits glycolysis and glutaminolysis in colorectal cancer cells by repressing c-Myc expression.
26292259 2015 Loss of NDRG2 promotes epithelial-mesenchymal transition of gallbladder carcinoma cells through MMP-19-mediated Slug expression.
26269411 2015 Loss of NDRG2 enhanced activation of the NF-?B pathway by PTEN and NIK phosphorylation for ATL and other cancer development.
26250123 2016 Epigenetic silencing of NDRG2 promotes colorectal cancer proliferation and invasion.
26239274 2015 N?Myc downstream?regulated gene 2 suppresses the proliferation of T24 human bladder cancer cells via induction of oncosis.
More...