Property Summary

NCBI Gene PubMed Count 122
PubMed Score 142.14
PubTator Score 127.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma -1.347 3.7e-04
adult high grade glioma -1.700 1.8e-07
atypical teratoid / rhabdoid tumor -3.100 7.7e-07
Barrett's esophagus -1.200 3.1e-02
Breast cancer -3.400 7.5e-32
breast carcinoma -2.100 5.9e-06
colon cancer -1.800 1.8e-03
cutaneous lupus erythematosus -1.200 2.0e-02
dermatomyositis -3.000 1.9e-03
Down syndrome 2.500 3.3e-03
ductal carcinoma in situ -1.500 7.7e-03
esophageal adenocarcinoma -1.600 1.8e-02
glioblastoma -1.500 6.9e-05
group 3 medulloblastoma -2.200 8.8e-08
interstitial cystitis -1.200 4.6e-03
invasive ductal carcinoma -1.725 6.3e-05
juvenile dermatomyositis -1.276 7.4e-05
lung adenocarcinoma -1.600 1.4e-15
lung cancer -2.100 3.5e-05
medulloblastoma, large-cell -3.500 2.9e-07
nasopharyngeal carcinoma -1.300 3.4e-06
non-small cell lung cancer -1.125 4.7e-11
pancreatic cancer -1.100 5.3e-03
pancreatic carcinoma -1.100 5.3e-03
primitive neuroectodermal tumor -2.000 4.9e-04
psoriasis 1.300 3.2e-02
subependymal giant cell astrocytoma -2.549 1.6e-02
ulcerative colitis -1.200 3.6e-05

Protein-protein Interaction (2)

Gene RIF (99)

AA Sequence

MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHD      1 - 70
VGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTI     71 - 140
IGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGN    141 - 210
SELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDP    211 - 280
TQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLS    281 - 350
QSSESGTLSSGPPGHTMEVSC                                                     351 - 371
//

Text Mined References (131)

PMID Year Title