Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.67
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.100 3.3e-02
atypical teratoid / rhabdoid tumor -1.500 1.8e-03
Breast cancer -1.600 4.0e-04
Common variable immunodeficiency -1.513 7.2e-03
lung cancer -1.400 1.9e-02
osteosarcoma 1.825 4.4e-03
ovarian cancer -1.700 4.0e-05
pancreatic cancer -1.100 1.9e-02
pancreatic carcinoma -1.100 1.9e-02
Pick disease -1.700 1.1e-05
progressive supranuclear palsy -1.500 1.4e-02
sonic hedgehog group medulloblastoma -1.100 3.9e-02
spina bifida -1.506 3.1e-02
tuberculosis -1.300 1.3e-04

Gene RIF (1)

AA Sequence

MMSNSSSEIDVIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDDVLIHCQVIYD      1 - 70
ALQNLDKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPT     71 - 140
LPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLC    141 - 210
LGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVD    211 - 280
LFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN                         281 - 329
//

Text Mined References (9)

PMID Year Title