Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.67
PubTator Score 2.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 1.10974267836269E-5
ovarian cancer 8492 3.98329862324463E-5
tuberculosis 1563 1.26640443952445E-4
Breast cancer 3099 4.04124317585205E-4
atypical teratoid / rhabdoid tumor 4369 0.00180486953415849
osteosarcoma 7933 0.00443838865809058
Common variable immunodeficiency 98 0.00718899193188076
progressive supranuclear palsy 674 0.0139237857473377
lung cancer 4473 0.018706519005985
pancreatic cancer 2300 0.0190076030455704
pancreatic carcinoma 567 0.0190076030455704
spina bifida 1064 0.0309846801945262
astrocytic glioma 2241 0.0325010536796052
sonic hedgehog group medulloblastoma 1482 0.0394430932145674

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer -1.100 0.019
astrocytic glioma -1.100 0.033
osteosarcoma 1.825 0.004
atypical teratoid / rhabdoid tumor -1.500 0.002
tuberculosis -1.300 0.000
Common variable immunodeficiency -1.513 0.007
lung cancer -1.400 0.019
sonic hedgehog group medulloblastoma -1.100 0.039
pancreatic carcinoma -1.100 0.019
spina bifida -1.506 0.031
Pick disease -1.700 0.000
progressive supranuclear palsy -1.500 0.014
Breast cancer -1.600 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q9UN30 B0FZN6 B2RA08 Q5H968 Q5H969
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

Gene RIF (1)

PMID Text
18601738 the molecular evolutionary pattern of SCML1 in diverse primate species showed a strong signature of adaptive evolution which is caused by Darwinian positive selection

AA Sequence

MMSNSSSEIDVIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDDVLIHCQVIYD      1 - 70
ALQNLDKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPT     71 - 140
LPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLC    141 - 210
LGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVD    211 - 280
LFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN                         281 - 329
//

Text Mined References (9)

PMID Year Title
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18601738 2008 Adaptive evolution of SCML1 in primates, a gene involved in male reproduction.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9570953 1998 Characterization of SCML1, a new gene in Xp22, with homology to developmental polycomb genes.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.