Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.14
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.4e-04
Breast cancer 3578 3.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.600 3.0e-02
ovarian cancer 1.400 2.4e-04

Gene RIF (3)

AA Sequence

MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRR      1 - 70
RYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNER     71 - 140
CLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA                                          141 - 172
//

Text Mined References (21)

PMID Year Title