Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.17
PubTator Score 2.53

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.40529251551822E-4
Breast cancer 3099 0.0301680466852889


  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.600 0.030
ovarian cancer 1.400 0.000


Accession Q9UMY4 F8W8K5 Q8WUG9




  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (3)

22719997 find that overexpression of SNX12 restores the sorting process in an Hrs knockdown background. Altogether, our data show that despite lower expression level, SNX12 shares redundant functions with SNX3 in the biogenesis of multivesicular endosomes
22709416 SNX12 protein level is dramatically decreased in the brain of Alzheimer's disease patients as compared to that of controls.
16166738 Metallothionein deficient mice have a marked decrease in Snx12 during acute lung injury

AA Sequence

CLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA                                          141 - 172

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22719997 2012 SNX12 role in endosome membrane transport.
22709416 2012 Sorting nexin 12 interacts with BACE1 and regulates BACE1-mediated APP processing.
22109349 2012 Expression of sorting nexin 12 is regulated in developing cerebral cortical neurons.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.