Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $29,890.2
PubMed Score 5.45
PubTator Score 8.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.032 0.004
Multiple myeloma 1.190 0.007
psoriasis 1.200 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.001
lung cancer 2.200 0.000
ovarian cancer 2.500 0.000
dermatomyositis 1.200 0.000

Gene RIF (4)

PMID Text
23085760 NOL7 significantly alters TSP-1 expression and may be a master regulator that coordinates the post-transcriptional expression of key signaling factors critical for the regulation of the angiogenic phenotype.
22123719 NOL7 is the legitimate tumor suppressor gene located on 6p23.
21818416 Three alternatively spliced forms of the human NOL7 gene coding for relatively small proteins were identified
20206243 determined that the essential elements required for the optimal promoter activity of NOL7 were 560 bp upstream of its translation start site.

AA Sequence

MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFA      1 - 70
SAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEV     71 - 140
NLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNK    141 - 210
FLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK                           211 - 257
//

Text Mined References (20)

PMID Year Title
23308053 2012 The RB tumor suppressor positively regulates transcription of the anti-angiogenic protein NOL7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085760 2013 The novel tumor suppressor NOL7 post-transcriptionally regulates thrombospondin-1 expression.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22123719 2012 Characterization of NOL7 gene point mutations, promoter methylation, and protein expression in cervical cancer.
21818416 The dynamics of the alternatively spliced NOL7 gene products and role in nucleolar architecture.
20875127 2010 Identification and functional analysis of NOL7 nuclear and nucleolar localization signals.
20206243 2010 Identification and characterization of the human NOL7 gene promoter.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...