Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.45
PubTator Score 8.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.100 2.5e-04
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-03
lung cancer 1.600 2.8e-04
Multiple myeloma 1.153 1.8e-03
ovarian cancer -1.100 7.5e-03
psoriasis 1.200 2.4e-04
Waldenstrons macroglobulinemia 1.032 4.5e-03

Synonym

Accession Q9UMY1 Q5T297 Q9Y3U7
Symbols PQBP3
RARG-1
C6orf90
dJ223E5.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFA      1 - 70
SAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEV     71 - 140
NLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNK    141 - 210
FLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK                           211 - 257
//

Text Mined References (21)

PMID Year Title