Property Summary

NCBI Gene PubMed Count 62
PubMed Score 276.51
PubTator Score 125.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 9.7e-03

Protein-protein Interaction (11)

Gene RIF (56)

AA Sequence

MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLY      1 - 70
SIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVW     71 - 140
AISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYLLGAIDWAHLELGRL    141 - 210
LGTEFQVMFFFSALVLTLCFTVHLCSISEAPLTEVAKGIPPQQTPQDPPLSSDGMYEYGSIEKVKNGYVN    211 - 280
PELAMQGAKNKNHAEQTRRAMTLKSLLRALVNMPPHYRYLCISHLIGWTAFLSNMLFFTDFMGQIVYRGD    281 - 350
PYSAHNSTEFLIYERGVEVGCWGLCINSVFSSLYSYFQKVLVSYIGLKGLYFTGYLLFGLGTGFIGLFPN    351 - 420
VYSTLVLCSLFGVMSSTLYTVPFNLITEYHREEEKERQQAPGGDPDNSVRGKGMDCATLTCMVQLAQILV    421 - 490
GGGLGFLVNTAGTVVVVVITASAVALIGCCFVALFVRYVD                                  491 - 530
//

Text Mined References (63)

PMID Year Title