Property Summary

NCBI Gene PubMed Count 17
PubMed Score 42.35
PubTator Score 38.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.594 2.3e-06

Gene RIF (7)

AA Sequence

MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGD      1 - 70
NTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLL     71 - 140
TPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF              141 - 200
//

Text Mined References (16)

PMID Year Title