Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.41
PubTator Score 6.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.3e-15
malignant mesothelioma 3232 6.7e-06
psoriasis 6694 2.6e-05
group 4 medulloblastoma 1855 7.1e-04
Disease Target Count Z-score Confidence
Autosomal dominant nonsyndromic deafness 9 5 3.898 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma -1.200 7.1e-04
lung carcinoma 1.100 1.3e-15
malignant mesothelioma -1.200 6.7e-06
psoriasis 1.800 2.6e-05

Synonym

Accession Q9UMX5 A1KYQ8 Q53FZ6 Q5TM90
Symbols CIR2
SPUF
SCIRP10

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG      1 - 70
VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV     71 - 140
GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF                                          141 - 172
//

Text Mined References (15)

PMID Year Title