Property Summary

NCBI Gene PubMed Count 7
Grant Count 10
R01 Count 9
Funding $754,218.25
PubMed Score 22.80
PubTator Score 6.84

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis 1.800 0.000
group 4 medulloblastoma -1.400 0.000
lung carcinoma 1.100 0.000

Gene RIF (3)

PMID Text
24763612 High NENF expression is associated with liver cancer.
18056703 Describes the predicted heme-binding domains in the human neudesin protein sequence.
15605373 Human neudesin of 172 amino acids with high similarity ( approximately 91% identity) to mouse neudesin was identified; the human neudesin gene was mapped to chromosome 1p33.

AA Sequence

MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG      1 - 70
VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV     71 - 140
GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF                                          141 - 172
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24763612 2014 Genome-wide study of hypomethylated and induced genes in patients with liver cancer unravels novel anticancer targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22748190 2012 The functional and structural characterization of a novel oncogene GIG47 involved in the breast tumorigenesis.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18056703 2008 Neurotrophic activity of neudesin, a novel extracellular heme-binding protein, is dependent on the binding of heme to its cytochrome b5-like heme/steroid-binding domain.
16645950 2006 Breast cancer proteomics by laser capture microdissection, sample pooling, 54-cm IPG IEF, and differential iodine radioisotope detection.
15605373 2005 Neudesin, a novel secreted protein with a unique primary structure and neurotrophic activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...