Property Summary

NCBI Gene PubMed Count 27
PubMed Score 42.64
PubTator Score 65.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 IMPC Phenotype (1)

Gene RIF (14)

AA Sequence

MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVL      1 - 70
LRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQ     71 - 140
AQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLP    141 - 210
ER                                                                        211 - 212
//

Text Mined References (28)

PMID Year Title