Property Summary

NCBI Gene PubMed Count 24
Grant Count 19
R01 Count 12
Funding $4,912,449.01
PubMed Score 37.85
PubTator Score 65.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
24806027 Data suggest that hypoxia-induced expression of BOK in placental cells is regulated via promoter region, hypoxia-response element, and binding of hypoxia-inducible factors (HIF1A, HIF2A/EPAS1, HIF1B/ARNT) but is not affected by its antisense transcript.
24113155 First evidence for a key role of the BOK-MCL1 system in regulating autophagy in the human placenta, whereby an adverse environment as seen in preeclampsia tilts the BOK-MCL1 balance toward the build-up of isoforms that triggers placental autophagy.
23884412 Bok may govern IP3R cleavage and activity during apoptosis.
20673843 The results suggest important roles for Bok and Bcl-X(L) in human ovarian development, follicle maturation and apoptosis.
19942931 Data conclude that Mtd-L functions to regulate trophoblast cell proliferation during early placentation and that the elevated levels of Mtd found in PE may contribute to increased trophoblast proliferation.
19287972 BOKAS is a natural antisense transcript that regulates the pro-apoptotic activity of human Bok
16772296 Bok represents a cell cycle-regulated pro-apoptotic member of the Bcl-2 family
16302269 a link between the apoptotic activity and nuclear localization of a pro-apoptotic Bok
15868100 Studies showed that hBok was distributed in both the cytosol and intracellular membranes of healthy cells.
15775999 A novel Mtd/BOK splice isoform is responsible for trophoblast cell death in pre-eclampsia.
More...

AA Sequence

MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVL      1 - 70
LRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQ     71 - 140
AQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLP    141 - 210
ER                                                                        211 - 212
//

Text Mined References (26)

PMID Year Title
27505430 2016 Bok is a genuine multi-BH-domain protein that triggers apoptosis in the absence of Bax and Bak.
27076518 2016 Bok is a genuine multi-BH-domain protein that triggers apoptosis in the absence of Bax and Bak.
24806027 2014 Hypoxia-inducible regulation of placental BOK expression.
24113155 2013 Placental autophagy regulation by the BOK-MCL1 rheostat.
23884412 2013 The Bcl-2 protein family member Bok binds to the coupling domain of inositol 1,4,5-trisphosphate receptors and protects them from proteolytic cleavage.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
20673843 2010 Regulation of cell death in human fetal and adult ovaries--role of Bok and Bcl-X(L).
20171287 2010 Voxelwise genome-wide association study (vGWAS).
19942931 2010 Mtd/Bok takes a swing: proapoptotic Mtd/Bok regulates trophoblast cell proliferation during human placental development and in preeclampsia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...