Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.57
PubTator Score 8.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.500 0.000
osteosarcoma -2.886 0.000
lung cancer 1.200 0.010
ductal carcinoma in situ 1.700 0.005
invasive ductal carcinoma 1.300 0.025

Synonym

Accession Q9UMX2 E7EUE7 Q6GMR0 AZ3
Symbols AZ3
OAZ-t
TISP15

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
16542438 Observational study of gene-disease association. (HuGE Navigator)
16542438 Mutations in the OAZ3 gene are not a common cause of male infertility.
10781085 antizyme expression requires programmed, ribosomal frameshifting

AA Sequence

MPCKRCRPSVYSLSYIKRGKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYKEEEDLTLQPR      1 - 70
SCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDPLLHQDPVQLDFHFRLTSQTSAHWHGLLC     71 - 140
DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPAL    141 - 210
PPLDNVIFMVYPLERDVGHLPSEPP                                                 211 - 235
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21630459 2011 Proteomic characterization of the human sperm nucleus.
17900240 2008 Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16542438 2006 Identification of polymorphisms and balancing selection in the male infertility candidate gene, ornithine decarboxylase antizyme 3.
15642376 2005 Yeast two-hybrid screens imply that GGNBP1, GGNBP2 and OAZ3 are potential interaction partners of testicular germ cell-specific protein GGN1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355308 2005 Regulation of all members of the antizyme family by antizyme inhibitor.
More...