Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.32
PubTator Score 8.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ 1.700 5.0e-03
invasive ductal carcinoma 1.300 2.5e-02
lung cancer 1.200 9.6e-03
osteosarcoma -2.886 3.7e-12
psoriasis -2.500 1.0e-05

Gene RIF (3)

AA Sequence

MPCKRCRPSVYSLSYIKRGKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYKEEEDLTLQPR      1 - 70
SCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDPLLHQDPVQLDFHFRLTSQTSAHWHGLLC     71 - 140
DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPAL    141 - 210
PPLDNVIFMVYPLERDVGHLPSEPP                                                 211 - 235
//

Text Mined References (14)

PMID Year Title