Property Summary

NCBI Gene PubMed Count 86
PubMed Score 86.97
PubTator Score 74.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.314 1.7e-05
astrocytic glioma -1.200 2.8e-02
Breast cancer 1.200 4.2e-07
invasive ductal carcinoma 1.200 1.2e-03
osteosarcoma -1.366 8.8e-03
ovarian cancer -2.000 2.5e-07
pancreatic ductal adenocarcinoma liver m... -1.654 3.4e-02

Gene RIF (59)

AA Sequence

MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFK      1 - 70
SHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSG     71 - 140
SATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIM    141 - 210
ANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQ    211 - 280
EPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTA    281 - 350
SGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN    351 - 420
NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGA    421 - 490
LGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFL    491 - 560
NREANLQALIATGGDINAAIERLLGSQPS                                             561 - 589
//

Text Mined References (100)

PMID Year Title