Property Summary

NCBI Gene PubMed Count 79
Grant Count 63
R01 Count 33
Funding $9,636,001.8
PubMed Score 84.40
PubTator Score 74.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.200 0.028
osteosarcoma -1.366 0.009
acute quadriplegic myopathy 1.314 0.000
pancreatic ductal adenocarcinoma liver m... -1.654 0.034
invasive ductal carcinoma 1.200 0.001
ovarian cancer 2.200 0.001
Breast cancer 1.200 0.000

Synonym

Accession Q9UMX0 A0A024R284 Q5T6J5 Q5T6J9 Q8IXS9 Q8N2Q3 Q9H0T8 Q9H3R4 Q9HAZ5
Symbols DA41
DSK2
UBQN
XDRP1
PLIC-1

Gene

PDB

2JY6   2JY5   2KLC  

Gene RIF (55)

PMID Text
26563932 Results suggest that ubiquilin-1 may mechanistically participate in Alzheimer's disease molecular pathogenesis by affecting BACE1 and thereby APP processing and Abeta accumulation
26406952 The expression level of UBQLN1 and prognosis in breast cancer is clarified for the first time and UBQLN1 seems to be a novel molecular marker to predict poor prognosis in breast cancer.
26261684 Chloroquine derivative D5 downregulates presenilin expression via the inhibition of ubiquilin 1 expression.
25387430 These results suggest that the UBQ-8i polymorphism is associated with Alzheimer's disease risk.
25044403 High UBQLN1 expression is associated with low radiosensitivity in breast cancer.
25010605 The results suggest that UBQ-8i polymorphism may contribute to Alzheimer's disease susceptibility, but does not synergize with APOEepsilon4 status to increase Alzheimer's disease risk.
24747970 found that ZEB1 is required for induction of mesenchymal-like properties following loss of UBQLN1 and ZEB1 is capable of repressing expression of UBQLN1
24475300 Human ubiquilin-1 overexpression in transgenic mice increases the lifespan and delays accumulation of Huntingtin aggregates in the R6/2 mouse model of Huntington's disease.
23869942 The results demonstrate that in Alzheimer's disease hippocampus, ubiquilin-1 immunoreactivity increases in the neuronal nucleoplasm and is associated with region-specific neurofibrillary changes.
23774650 results were confirmed by similar findings for ubiquilin-1 and -2 in human brain tissue sections, where accumulation was observed in huntingtin inclusions
More...

AA Sequence

MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFK      1 - 70
SHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSG     71 - 140
SATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIM    141 - 210
ANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQ    211 - 280
EPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTA    281 - 350
SGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN    351 - 420
NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGA    421 - 490
LGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFL    491 - 560
NREANLQALIATGGDINAAIERLLGSQPS                                             561 - 589
//

Text Mined References (93)

PMID Year Title
26563932 2016 Relationship between ubiquilin-1 and BACE1 in human Alzheimer's disease and APdE9 transgenic mouse brain and cell-based models.
26406952 2015 Prognostic significance of Ubiquilin1 expression in invasive breast cancer.
26261684 2015 Inhibitory effect of chloroquine derivatives on presenilin 1 and ubiquilin 1 expression in Alzheimer's disease.
25416956 2014 A proteome-scale map of the human interactome network.
25387430 2014 Meta-analysis of Ubiquilin1 gene polymorphism and Alzheimer's disease risk.
25044403 2015 MiR-200c inhibits autophagy and enhances radiosensitivity in breast cancer cells by targeting UBQLN1.
25010605 2015 Association of UBQ-8i polymorphism with Alzheimer's disease in Caucasians: a meta-analysis.
24747970 2015 Ubiquilin1 represses migration and epithelial-to-mesenchymal transition of human non-small cell lung cancer cells.
24674348 2014 The ubiquilin gene family: evolutionary patterns and functional insights.
24475300 2014 Ubiquilin-1 overexpression increases the lifespan and delays accumulation of Huntingtin aggregates in the R6/2 mouse model of Huntington's disease.
More...